Description
App Information White-rumped Shama
- App NameWhite-rumped Shama
- Package Namecom.tone.kicauburung.muraibatu
- UpdatedOctober 31, 2016
- File SizeUndefined
- Requires AndroidAndroid 2.3.3 and up
- Version1.0
- DeveloperTone Apps
- Installs10 - 50
- PriceFree
- CategoryMusic & Audio
- Developer
- Google Play Link
Tone Apps Show More...
Ost Mermaid in Love 2 Lengkap 1.0 APK
Kumpulan Lagu Mermaid in Love 2 LengkapNikmati Lagu Sinetron Mermaid in Love SCTV sertaSinetronLainnya.Lagu Mermaid In Love 2 Lengkap merupakan aplikasi androidyangberisi kumpulan lagu-lagu terlengkap, terbaik dan terbaru dariOSTMermaid In Love Season 2.Lagu Vierra Kesepian, Rasa Ini, Seandainya, SemuaTentangmu,Terlalu Lama, Shae Aku Suka Kamu, Shae Cintaku Tlah MatiUntukmu,Shae Sayang, Tetaplah Tersenyum, Vierratale Bersamamu,Nikmati juga ost film terkenal lainya : Tukang OjekPengkolan,Surga yang ke 2, Ost Senandung, Rahasia Suara Hati, OstPrince,GGS, Pernikahan Dini,Mermaid collectionofsongs in Love 2 CompleteEnjoy songs SCTV soap opera Mermaid in Love and Othersoapopera.Mermaid song In Love 2 Complete is an android applicationwhichcontains the most complete collection of songs, the best andlatestof OST Mermaid In Love Season 2.Vierra songs Loneliness, Taste It, Had, All Tentangmu, TooOld,Shae I Love You, Wherever You Die For You My Love Shae,ShaeSayang, Keep Smiling, Vierratale Bersamamu,Enjoy ost other famous movie: Ojek Pengkolan, Heaven 2, OstHum,Secret Voice of the Heart, Ost Prince, GGS, Early Marriage,
Diet Plan - Weight Loss 1.0 APK
You can lose weight like The BiggestLosercontestants without having to spend timeat the ranch.There must be just a perfect guideline to add the right stufftoyour meal intake every day. Ingredient quality and quantity ofyourbreakfast, lunch and dinner should be scaled well in ordertheexperience the quickest and healthiest result.Features:- The Step Diet, Weight Watch, Best Life,The Solution, YounOnDiet, House, Japanese, G.I Diet, Flat Belly Diet, andmore...- FREE : Weight Loss Manual (PDF eBook)All these diets include various foods from the major foodgroups(fruits, vegetables, lean protein sources…) which you willenjoyeating for a lifetime. The meals contain proper amountsofnutrients and calories, plus physical activity (exercise) ispartof almost every diet plan.
Christian Music: Worship Songs 1.0 APK
Get the best christian songs music that allofus want to have!!Enjoy the best Android app to listen Christian music, RadioandWorship Songs• Nice design and simple interface• Set as Ringtone, Notification Sound, Default Alarm Sound• Share your tastes in social networks• Christian Music• Praise Worship, Gospel, Sermons, Contemporary Radio• Christian Music + Lyrics• Nikita• Sidney Mohede• Sari Simorangkir• Maria Shandi• Hillsong Songs• And more…Disclaimer:* To listen to the song , App must be connected to the internetviaWiFi / 3G / 4G .* All songs derived from various websites on the internet.Developers do not store songs in the App* All media / picture / song are the copyright holderofcopyright
Sounds of Nature. Relax music 1.0 APK
Sounds of Nature. Relax musicWant to improve brain work? and sleep better ?Choose from a list of 24 different good quality naturerelaxingsounds (sounds of nature) which include thunder, oceansounds, sea,birds sounds, rain, night in jungle, water sounds,waterfall,nature and start your personal audio therapy.Features :- Set as ringtone- Set as notification sound- Set as defauly alarm- Shuffle Songs- Repeat Mode
Bible Quotes 1.0 APK
Bible Quotes brings you many great versesfromthe bible. Get inspired by a new quote every day.Find your daily bible quotes that give you strength andcourageeveryday and which will remind you that lord god JesusChrist isalways with you.Get inspirational bible quotes and inspirational versesforChristians for everyday life. Bible Quotes about :Love,Heart,Heaven, Hope, JoyYou can also set picture as :-Display Picture BBM-Contact picture-Lock screen wallpaper-Wallpaper-WhatsApp profile photoFeatures1. User friendly interface2. Sorted by Category3. Share with friends via socialmedia platforms or apps4. Set Images as Wallpaper.5. Save Images to your gallery.6. Zoom In/ Zoom Out7. Slide Show Function.#The verses are taken from "http://www.kingjamesbibleonline.org"
Bible Verses Daily 1.0 APK
This app is for people who wants to haveadaily feed of verses to inspired them everyday.This beautiful and easy to use application will give you a newversefrom the Holy Bible every time you launch it.Bible Verses by Topic :Inspirational, Healing, Worry andAnxiety,Love, Friendship, Family, Forgivness, Relationship,Children,Encouraging, FaithFeatures :- Copy bible verses- Share- Translate bible verses#The verses are taken from " King James Version" ( KJV ) and"New International Version" (NIV ) of the Bible
Wind Sounds Nature 1.0 APK
Free Wind Sound Effects!With this free application you will improveyourconcentration.Relaxing sounds of wind sounds can also be used as backgroundmusicwhile learning and studying, reading, working, exercising andusingother applications, eg. reading e-books.Features :- High quality Wind music- Set as ringtone- Set as notification sound- Set as defauly alarm- Shuffle Songs- Repeat ModeWind sounds, the sound of trees and leaves are naturesoundswhich to help you relax and fall asleep, as wellregeneratestrength after a difficult and exhausting day.
Lagu Om Telolet Om Lengkap 1.0 APK
Lagu Om Telolet Om Dj RemixHalo Pecinta Suara Telolet dari Bus premium Indonesia !IniMerupakan aplikasi gratis untuk anda pencinta bus mania yangtepat.Dengan menggunakan aplikasi ini, ada dapat mendengarkanlagutelolet Terlengkap dan Terbaik. Selain itu, andajugamemanfaatkannya sebagai alaram dan ringtone hp kamu.Lagu :imeyney om telolet om, eka gustiwana, dangdut koplo, om teloletom,telolet bus terbaru, hard remix, bus murni nasional, masbaytelolet, sefan remix, gnaw remix, dj remix new telolet,Originaltelolet, remix dubstep edm version, trap remix, dj kindd,amhienputrea*Bonus70 klakson bus telolet lengkapTelolet Om Om songsDjRemixHello Lovers Sound Telolet of premium Bus Indonesia! This is afreeapplication for your lover mania right bus. By usingthisapplication, there can listen to songs telolet Complete andBest.In addition, you also use it as an alarm and yourphoneringtone.songs:imeyney om telolet om, eka gustiwana, dangdut, om teloletom,telolet bus newest, hard remix, bus purely national, masbaytelolet, sefan remix, Gnaw remix, dj remix new telolet,Originaltelolet, remix dubstep edm version, trap remix, dj kindd,amhienputrea*Bonus70 bus horn complete telolet
Similar Apps Show More...
Master Juara Kicau Terlengkap 2.0.2 APK
Master kicau mania terlengkap adalah aplikasi untuk para kicaumania yang menginginkan agar burungnya mempunyai suara yangmelimpah. Banyak kendala yang dialami oleh para kicau mania ataupenghobi burung diantaranya macet bunyi mbagong serak dan burungmempunyai sedikit vokal lagu dan iramanya monotone. Berlatarkendala tersebut maka dapat diatasi dengan aplikasi master kicaumania, Aplikasi ini bisa dibilang lengkap karena selain terdapatbanyak suara burung kasar terdapat juga suara burung kecil danlangka, dan Aplikasi ini terdapat juga informasi mengenai burungyang sangat bermanfaat.selain itu terdapat juga tips dan trik nyaantara lain : - cara merawat burung - cara membedakan burung jantandan betina - cara merawat trotol - cara menangani burung mabung -cara terapi burung macet pun ada Sedangkan isi dari burung tersebutantara lain : murai batu cucak jenggot atau kapas tembak anis merahanis kembang atau plontang cucak ijo kenari blackthroat beo cucakranti pleci cendet atau pentet cililin cucak rowo decu jalak kebojalak suren kepodang love bird pancawarna robin sirtu tengkek butotledekan gunung trucukan
Master Murai Unggulan 1.0 APK
Dihabitat aslinya kucica Hutan atau seringdisebut Burung Murai Batu cenderung memilih hutan alam yangrapatatau hutan skunder. Murai Batu merupakan kelompok burungyangdikenal sebagai teritorial dan sangat kuat dalammempertahankanwilayahnya.Burung murai batu mempunyai suara kicauan yang bagussehinggamendapatkan penghargaan terbaik atas nyanyianya yang sangatindahpada tahun 1947 < The Best Song Birds Delacour,1947>Penyebaran burung murai batu di pulau jawa saat ini sangatterbatasdan hanya di temukan di beberapa tempat yang berhutan,seperti ditempat konservasi dan tempat wisata alam contohnyaseperti TamanNasional Ujung Kulon dan Taman Nasional Meru Betiridan HutanWisata Pananjung Pangandaran.Dalam aplikasi ini terdapat audio kicauan dari berbagai jenisburungmurai dari murai medan,murai batu aceh, murai batuburneo,murai batunias,dll. yang terkenal akan kemerduan kicauanyabaik yang patahpatah maupun kicauan panjang.Semoga aplikasi ini bermanfaat.Forest kucicaoriginalhabitat or often called Burung Murai Batu tend to preferdensenatural forest or secondary forest. Murai Batu is a group ofbirdsknown as territorial and very strong in defendingitsterritory.Humming bird stone has a chirping sound great so get thebestrewards on nyanyianya very beautiful in 1947The spread of a humming bird stone on the island of Javaiscurrently very limited and only found in a few places wooded,likein conservation and natural tourist attractions for examplelikeUjung Kulon National Park and Betiri Meru National Park andForestTourism Pananjung Pangandaran.In this application there is audio chirp of various types ofmagpierobin field, magpie stone Aceh, burneo stone magpie, magpiestonenias, etc. famous for sonority kicauanya either broken orbrokenlong chirp.Hopefully this app useful.
Kicau Master Burung 1.0 APK
# Aplikasi ini menyediakan suara paramasterburung.# Bisa digunakan sebagai ringstone.# Melatih burung anda menjadikan master di kelasnya.# Berisi berbagai macam burung :- Kacer- Cucak rowo- Kenari- Cendet- Cucak Ijo- Murai- Lovebird- Dll# Aplikasi ini membutuhkan sambungan internet / wifi.# Semoga anda sukses dalam melatih burung anda.# Sebarkan aplikasi ini ke rekan anda.# Thisapplicationprovides the voice of the master of birds.# Can be used as ringstone.# To train the birds to make the master class.# It contains a wide variety of birds: - kacer - Cucak rowo - Walnuts - Cendet - Cucak Ijo - Murai - Love Bird - Etc# This app requires an internet connection / wifi.# May you be successful in training your bird.# Spread this app to your colleagues.
Master Burung ( 200 Lebih ) 1.0 APK
Sebuah aplikasi masteran burungdimanadidalamnya berisi dari puluhan bahkan ratusan jenis burungyangmempunyai kicauan yang bermacam-macam, ada yang panjang,superngekek, bahkan berkicau secara patah-patah.Dalam aplikasi ini terdapat lebih dari 200 masteran yangdiambildari berbagai jenis burung unggulan dan pastinya sudahpernah juaraseperti :- Murai Batu- Kenari- Cucak Ijo- Kacer- Cucak Rowo- Anis Kembang- Ciblek- Lovebird- Tengkek Buto- dan mash banyak lagiAplikasi ini bekerja secara offlinjadi jangan takutuntukmemainkanya karena tidak memakai data internet anda.Semoga aplikasi ini bermanfaat terutama untuk burung-burung diduniadan yang pasti untuk pemiliknya.A birdmasteranapplications where the inside of tens or even hundreds ofspeciesof birds that have varying chirp, there is a long, superngekek,even chirping is broken.In this application, there are more than 200 masteran takenfromdifferent species of bird seed and certainly has never wonsuchas:- Murai Batu- Walnuts- Cucak Ijo- kacer- Cucak Rowo- Anis Kembang- Ciblek- Love Bird- Tengkek Buto- And mash moreThis application works offlinjadi do not be afraid tomemainkanyafor not wearing your Internet data.Hopefully this application is useful especially for the birds intheworld and certainly to their owners.
Kicau Murai Batu Terlengkap 2.0 APK
aplikasi ini berisi 20 jenis kicau burungmurai batu yang dapat digunakan untuk melatih jenis suara ataukicauan burung murai batu.suara burung murai batu dalam aplikasiini dikumpulkan dari burung murai batu juara atau master burungmurai.dijamin burung murai batu anda akan gacor terus.selain itu aplikasi ini dapat digunakan sebagai ringtone maupunnada alaram di hp kamu.Keunggulan kicau murai batu :--> aplikasi gratis (tidak berbayar)--> tanpa koneksi internet--> terdapat bnyak fitur-fiturDaftar kicau burung murau batu :Kicau Murai Batu Juara 1Kicau Murai Batu Juara 2Kicau Murai Batu Juara 3Kicau Murai Batu Juara 4Kicau Murai Batu Juara 5Kicau Murai Batu Juara 6Kicau Murai Batu Juara 7Kicau Murai Batu Gacor 1Kicau Murai Batu Gacor 2Kicau Murai Batu Gacor 3Kicau Murai Batu Gacor 4Kicau Murai Batu Gacor 5Kicau Murai Batu Gacor 6Kicau Murai Batu Gacor 7Simulasi Lomba 1Simulasi Lomba 2Simulasi Lomba 3Simulasi Lomba 4Simulasi Lomba 5Kicau Murai Batu MasteranThis application contains20 kinds of birds chirping magpie stones that can be used to trainthe type of noise or humming bird chirp batu.suara humming birdstone in this application were collected from a humming bird stonemaster champion or a humming bird.guaranteed you'll be humming bird stone gacor continue.besides this application can be used as a ringtone or alarm tone onyour phone.Excellence chirping magpie stone:-> Application for free (unpaid)-> No internet connection-> There are bnyak featuresList of birdsong Murau stone:Chirping Murai Batu 1stChirping Murai Batu Champion 2Chirping Murai Batu 3rdChirping Murai Batu Champion 4Chirping Murai Batu Champion 5Chirping Murai Batu Champion 6Chirping Murai Batu Champion 7Chirping Murai Batu gacor 1Chirping Murai Batu gacor 2Chirping Murai Batu gacor 3Chirping Murai Batu gacor 4Chirping Murai Batu gacor 5Chirping Murai Batu gacor 6Chirping Murai Batu gacor 7Simulation Competition 1Simulation Competition 2Simulation Competition 3Simulation Competition 4Simulation Competition 5Chirping Murai Batu Masteran
Music & Audio Top Show More...
ViNyL Music Player 1.2.9 APK
The Top Music Player for Android. is amusthave music player for smart phones.Built-in powerful Bass Booster and Equalier, Quick scan allmusicfiles and The New Interactive Experience you have never hadbefore.HD Vinyl Playback, Over 10 gorgeous background skins to makeyourmusic player look more outstanding.And more than 3 desktop widgets make your music play never beensoeasy.Free to get this best music player pro.,b>Key Features:- Browse and play your music quickly by albums, artists,songs,playlists, and folders- HD Vinyl Playback style- 10 beautiful default skins or custom with your own photos- High quality decoding with mp3,mp4/m4a,wma,flac and ape- 3 home screen WIDGETS(4*1, 2*2, 4*1)- Music Library wide search. Find all your music never beensoeasy.- Audio Recorder- Sleep mode- Lock screen support.- Five band graphic equalizer and Bass Booster- 10 types of pre-set music one for you choice, or you canmanuallyadjust the equalizer- Lyric support, Automatic scanning all the lyric files ,andmatching the most appropriate lyrics file for your songs.- Headset support. Support one button and multiple buttonsheadsets.Leave your device in the pocket!- Notification STATUS support: display album artwork, titleandartist, play/pause, skip forward and stop CONTROLS innotificationstatus.To learn more about the advanced settings, please feel free todownand have a try. You won't be disappointed.
القران الكريم الحصري بدون نت 1.0 APK
تلاوة القران الكريم بصوت الشيخمحمودخليلالحصريبدون انترنتتلاوة عذبة ونقية للقارئ الشيخ محمود خليل الحصريلاتحتاج للاتصال بالانترنتقراءة الية للسور دون الحاجة للتدخل منك , امكانية اعاداةتلاوةالسورمناجل الحفظتشغيل تلاوة السور حتى لو كان الجهاز مغلقاارجو ان تنسونا من خالص دعاؤكم و لاتنسوامشاركةالتطبيقمعاصدقائكمQuranrecitationbySheikhMahmoud Khalil exclusive without InternetSolemn fresh and pure the reader,SheikhMahmoudKhalilexclusiveDo not need to connect to the InternetRead the mechanism of the wall without the needforinterventionfromyou, the possibility of Aadah recitationfenceforconservationRun recitation of the fence, even if the device isswitchedoffI hope that you forget the sincere prayers and not forgettosharetheapplication with your friends
Emma for Spotify (TV) 1.00 APK
*** Spotify PremiumAccountisnecessary***Info that Emma will shut down on Jan 28, 2017.All + features are free starting from now (November 2016)***************************************************You need a Spotify Premium Account to use this software.- Access to top playlists (Top 100, Viral, Pop, Rock, etc.)- Access to New Releases, New Albums and Featured PlayLists- Play album, top songs, start radio, play any Playlistviavoicecommand- save songs to your Library & follow playlists.***If this app does not work for you, don't buy the+version,because it will not solve the problem*** Some userhaveproblemsusing it on Sony Bravia TVswith Emma for Spotify+ you will get:- more Categories, more Featured Playlists, Recent Playlists- MyLibrary screen with your Songs, Artists,AlbumsandPlaylistsincl. features to remove tracks from Libraryandunfollowplaylists.- Shortcuts on mediaplayer screen (Play Artist TopSongs,StartArtist Radio, Play full Album, Save Tracks)- a feature to add tracks to your own playlists.Examples for Voice Commands:Systemwide Voice Commands like "Play Coldplay" or"PlayMyloXyloto"In App-Voice Commands:- "Play Coldplay" plays Top Songs from Coldplay- "Album Coldplay Live 2012" plays specific Album- "Radio Coldplay" starts radio based on similar Artists- "Playlist Chill Out" plays a playlist named chill out- "Dance Music" or "Chill Out" searches andshowsspecificplaylists.This app is designed to work on AndroidTV!This app uses the official spotify beta sdkforandroid(https://developer.spotify.com/technologies/spotify-android-sdk)butisnot endorsed, certified or otherwise approved in any waybySpotify.Spotify is the registered trade mark of theSpotifyGroup.
Cat Sounds Ringtones 2.0 APK
Cat Sounds Ringtones is a brand newappthatbrings all the best cat sounds to your phone! All youcatloversout there are going to be so pleased with this greatapp.CatSounds is a collection of most adorable cat noises,kittysoundsand cat meowing sounds. You will find every possiblesoundthatyour favorite animal makes right here! You can choose fromarichselection of all natural cat sounds and set your favoritesoundasa ringtone, SMS notification or alarm sound. Wake upeverymorningwith your phone purring just like a real cat does!DownloadCatSounds Ringtones for free now and turn your smartphoneintomeowingcat![ Features ]- Hold the play button to set sound as ringtone,notificationsound(SMS/email) or alarm.- Assign as ringtone to specific contact in your contactlist.- Easy to use UI, Cat Sounds Ringtones works inlandscapeandportrait mode, optimized for all tablets andsmartphones.- Most popular cat sounds on the market!Kids are the biggest animal lovers and they are goingtoadorethese cat sounds! They will have so much fun hearingthesebestringtones. You will put a smile on their face every timeyouplay afunny cat sound. You will be surprised how much joythesecatsounds can bring. Browse through an extensive selectionofvariouslovely free ringtones. Pick your favorite free soundfromthis catsound effects soundboard and set it as a SMSalertnotification,chat notification, ringtone or alarm sound!Download“Cat SoundsRingtones” and enjoy them with your family!It’s time to turn your phone into your favorite animal!Youwillbe the center of attention whenever your phone makes asound.Alltrue cat lovers are going to be thrilled when they hearyourphoneringing. Share Cat Sounds Ringtones with your friendswhoadorecats! They are going to be most thankful and willappreciateyoufor discovering and sharing these cool ringtones withthem.CatSounds Ringtones is the best collection of topringtones,meowingSMS notification sounds and purring alarm tones.Bedelightedwhenever your phone meows! Download Cat SoundsRingtonesfor freenow.Feel free to contact us for any questions or feedback.
Best Car Sounds 2.1 APK
Best Car Sounds delivers theultimateexperiencewhen it comes to expensive and high-quality, topnotchvehiclesounds. This new app is bringing you the bestcollection ofthehottest incoming call alert melodies, SMSnotification soundsandloud alarm tones. Car lovers will startloving their favoritecarseven more because of these realistic andloud engine sounds.Yourmobile phone will sound so cool, like neverbefore, and yourheartwill beat faster when you hear that thrillingsound ofengineignition or the sound of tires screeching onasphalt. DownloadBestCar Sounds for free now and start your race!- Best new futuristic ringtones & SMS sounds!- Set as ringtone, notification sound (SMS/email) or alarm.- Assign as ringtone to specific contact in your contactlist.- Easy to use UI, Best Car Sounds App works in landscapeandportraitmode.Best Car Sounds is the newest most popular app foryoursmartphone!Assign different tunes for each contact and enjoythesepowerfulblasting sounds on daily basis. It is a loud andamusingway to getthe best out of every phone call or SMS you getand todraweveryone`s attention. Get your daily dose of adrenalinewiththesecrazy new roaring ringtones right now! If you feel theneedforspeed, these ringtones will awaken the passion in you andyouwillbe under the impression that you’re racing with anothercarthat isspeeding up right next to you. Go “fast and furious”withBest CarSounds! Anyone with passion for fast cars andpowerfulvehicleswill go crazy about these ringtones.Feel free to contact us for any questions or feedback.
Amex UNSTAGED: Taylor Swift 1.2.0 APK
Step inside acinematicinteractivemusicalexperience starring Taylor Swift. Choosewhereyou go, whoyoufollow and what you explore in a stunninghousefilledwithcharacters, objects and scenes.Shot with groundbreaking 360° cameras and scored witharichaudiosoundtrack based on Taylor’s single ‘Blank Space’fromhernew album1989, the experience is an immersivejourneywithintertwinedstorylines, multiple rooms and dozensofhiddeninteractive featureswaiting to be unlocked andexplored.The app also features the original ‘Blank Space’musicvideo,1989album purchase details and tour ticketinginformation.You canalsoexplore exclusive behind the scenes footagefrom theTaylorSwiftshoot, as well as the archive of Amex UNSTAGEDliveeventsand filmswith other top artists.The American Express UNSTAGED app is intended for ages 13+.
Lagu Natal 2017 1.2 APK
Natal (dari bahasa Portugisyangberarti"kelahiran") adalah hari raya umat Kristen yangdiperingatisetiaptahun oleh umat Kristiani pada tanggal 25Desemberuntukmemperingati hari kelahiran Yesus Kristus. Nataldirayakandalamkebaktian malam pada tanggal 24 Desember; dankebaktianpagitanggal 25 Desember. Beberapa gereja Ortodoksmerayakan Natalpadatanggal 6 Januari (lihat pula Epifani).Dalam tradisi barat, peringatan Natal jugamengandungaspeknon-agamawi. Beberapa tradisi Natal yang berasaldari Baratantaralain adalah pohon Natal, kartu Natal, bertukarhadiah antaratemandan anggota keluarga serta kisah tentang SantaKlausatauSinterklas.Kata “natal” berasal dari ungkapan bahasa Latin DiesNatalis(HariLahir).Dalam bahasa Inggris perayaan Natal disebutChristmas,dariistilah Inggris kuno Cristes Maesse (1038) atauCristes-messe(1131),yang berarti Misa Kristus. Christmas biasapula ditulisΧ'mas, suatupenyingkatan yang cocok dengan tradisiKristen, karenahuruf X dalambahasa Yunani merupakan singkatan dariKristus ataudalam bahasaYunani Chi-Rho.Untuk menyambut natal dan tahun baru, makakamimengembangkansebuah aplikasi yang berisi kumpulan lagu-laguNatalyang populerbaik di Indonesia maupun Dunia, adapun lagu-lagunatalyang kamisajikan pun cukup lengkap, antara lain :♦ Jingle Bells♦ We Wish You Merry Christmas♦ Selamat Hari Natal dan Tahun Baru♦ Telah Datang♦ Kita Rayakan Hari Natal♦ Oh Holy Night♦ Malam Sunyi Senyap♦ Sebab Dia Lahir Bagi Kita♦ Christmas is Here♦ Angel We have heard on High♦ Malam Kudus♦ Gita Surga Bergema♦ Hai Mari berhimpun♦ The first Noel♦ Twelve days of Christmas♦ Oh come little children♦ Hark the herald angels sing♦ Natal Pertama♦ dllFitur :♦ Bisa dijadikan ringtone hp♦ Bisa dijadikan alarm♦ Bisa dijadikan nada notifikasi♦ Tidak membutuhkan koneksi internet♦ Sudah menerapkan android 7♦ Aplikasi GratisSemoga dengan hadirnya aplikasi Lagu Natal 2017inibermanfaatbagi anda yang merayakan, jangan lupa ratedanreviewnya!!Christmas(fromPortuguesemeaning "birth") is a Christian holiday whichiscelebrated annuallyby Christians on December 25 to commemoratethebirth of JesusChrist. Christmas is celebrated in theeveningservice on December24; and service in the morning ofDecember 25.Some Orthodoxchurches celebrate Christmas on 6 January(see alsoEpiphany).In the western tradition, Christmas warningalsocontainsnon-religious aspects. Some Christmas traditions fromtheWestinclude Christmas trees, Christmas cards, exchanginggiftsbetweenfriends and family members as well as the story ofSantaClaus orSanta Claus.The word "Christmas" comes from the LatinphraseAnniversary(Birthday) .In English Christmas celebrationcalledChristmas, fromthe old English term Cristes Maesse (1038)orCristes-messe (1131),which means Mass of Christ. Christmasusuallyalso written Χ'mas, ashortening that fits with theChristiantradition, because theletter X in Greek is an abbreviationof theChrist or the GreekChi-Rho.To welcome Christmas and new year, we developedanapplicationthat contains a collection of Christmas songsarepopular inIndonesia and the World, while the Christmas songsthatwe serve isquite complete, among others:♦ Jingle Bells♦ We Wish You a Merry Christmas♦ Merry Christmas and Happy New Year♦ Has Come♦ We Celebrate Christmas♦ Oh Holy Night♦ Silent Night Silent♦ Because He is Born for Us♦ Christmas is Here♦ Angel We Have Heard on High♦ Holy Night♦ Gita Heaven Bergema♦ Hi Mari rally♦ The first Noel♦ Twelve days of Christmas♦ Oh come little children♦ Hark the herald angels sing♦ First Christmas♦ etc.Features:♦ Can be used as a ringtone hp♦ Can be used as alarm♦ Can be used as a notification tone♦ Does not require an internet connection♦ Already applying android 7♦ Free AppsHopefully with the presence of a Christmassong2017application is beneficial for those who celebrate, donotforgetrate and the review !!