Description
App Information Radio Dangdut Indonesia Online
- App NameRadio Dangdut Indonesia Online
- Package Namecom.kumpulan.radio.dangdut.indonesia.full
- UpdatedMarch 19, 2017
- File SizeUndefined
- Requires AndroidAndroid 2.3.3 and up
- Version1.4
- Developerelz
- Installs10 - 50
- PriceFree
- CategoryMusic & Audio
- Developer
- Google Play Link
elz Show More...
Analisa Nama 1.0 APK
Saya ucapkan Terimakasih bagi anda yang sudahmeluangkan waktu untuk membaca deskripsi saya.Pertama yakinlah bahwa semua ilmu adalah milik Sang Khalik, tetappercaya kepadaNYA.Kedua melalui aplikasi sederhana ini kami mencoba membantu andauntuk menemukan arti nama sesuai metode yang di terapkan dalamfengshui cina. " Tuntutlah ilmu sampai kenegeri China " - bermuladari bahasa klasik tersebutlah kenapa metode numerology nama darichina yang digunakan.dengan adanya aplikasi ini diharapkan mampu membantu anda untukmemberikan nama.aplikasi ini dapat digunakan untuk mengetahui :arti nama toko, arti nama bayi, nama jawa, nama islam, arti namaanda, arti nama usaha.Masih perlu bantuan? Beri tahu kami selengkapnya tentang masalahAnda.I say Thank you for thoseof you who've taken the time to read my description.The first rest assured that all science is the property of theCreator, continue to believe in Him.Both through this simple application we are trying to help you tofind the meaning of the name according to the method applied inChinese fengshui. "Seek knowledge to the land of China" - stemsfrom the classical language is exactly why numerology methods ofchina used name.with this application should be able to help you to give a name.This application can be used to determine:the meaning of the name of the store, meaning the baby's name, thename Javan, the name of Islam, the meaning of your name, businessname meaning.Still need help? Tell us more about your problem.
Tata Cara Mandi Wajib lengkap 1.8 APK
Satu aplikasi yang paling lengkaptentangpengetahuan mengenai tatacara dan tertib MandiWajibTerLengkap..Mungkin kebanyakan dari kita tidak menyedari secara sadar atautidaktentang mandi wajib yang kita lakukan itu sahatausebaliknya..Jadi didalam Aplikasi Panduan Mandi Wajib Lengkap ini adamengajarkita tatacara dan panduan penting dalam mengerjakan mandiwajibyang sah dan mengikut sunnah, berisikan tata cara mandidalamislam, yaitu mandi wajib dan mandi sunnah, sunnah sunnahmandi,sebab diharuskan mandi wajib, sunnah mandi wajib.Juga di lengkapi berbagai niat mandi wajib. Yaitu- niat mandi haid dan junub sekaligusSemoga Aplikasi mandi wajib ini dapat memberikan sedikitsebanyakIlmu dan manfaat yang berguna kepadasemua...INSYAALLAH.dengan desain yang bagus membuat anda tidak bosan melihataplikasiini.fitur1. aplikasi OFFLINE, dapat anda gunakan tanpa adanyakoneksiinternet2. ukuran kecil3. fitur akan di tambah seiring berjalannya waktu4. tidak boros ram5. paling lengkap di antara aplikasi sejenisnya.One of the mostcompleteapplication of knowledge about procedures and orderly Ghuslmostcomplete ..Perhaps most of us do not realize it consciously or not abouttheobligatory shower we did was legitimate or otherwise ..So in Application Guide Ghusl Complete have taught us rulesandguidance is essential in doing bathing shall be valid andfollowthe Sunnah, containing procedures for bathing in Islam,namely bathmandatory and shower sunnah, sunnah sunnah shower,because therequired bathing mandatory, sunnah showermandatory.Also equipped various intentions mandatory shower. That is- Shower intention period and at the same junubHopefully this application shall baths can give a little asScienceand useful benefits to all ... inshaAllah.with good design makes you not get tired of seeingthisapplication.features1. OFFLINE application, you can use without aninternetconnection2. small size3. The features will be added over time4. not wasteful ram5. The most complete among similar applications.
Asmaul Husna 99 nama Allah 1.0 APK
Allah SWT berfirman dalam surat Al-Arafayat180:"Hanya milik Allah Asmaa-ul Husna, maka bermohonlahkepada-Nyadengan menyebut Asmaa-ul Husna itu dan tinggalkanlahorang-orangyang menyimpang dari kebenaran dalam (menyebut)nama-nama-Nya.Nanti mereka akan mendapat balasan terhadap apa yangtelah merekakerjakan"Pelajari nama-nama indah Allah dengan Audio/Lagu terjemahandanhuraiannya. Antara cara yang terbaik untuk menghafalnama-namaAllah ini adalah dengan Audio/Lagu.Dengarkan audio dan bantu diri serta anak-anak anda untukmenghafalnama-nama Allah yang indah dengan satu-satunyaaplikasiAsmaul Husna adalah nama-nama yang baik milik Allah SWT.Secaraharfiyah, pengertiannya adalah "nama-nama yang baik". AsmaulHusnamerujuk kepada nama-nama, gelar, sebutan, sekaligussifat-sifatAllah SWT yang indah lagi baik.Konten :* Asmaul Husna berarti nama-nama indah Allah seperti yangdisebutkandalam Al Quran, yang masing-masingmemiliki arti definisi / pengertian yang baik, muliadanindah.* Aplikasi ini dilengkapi dengan Arti,makna dan fadillah dariasmaulhusna.* Asmaul Husna merupakan aplikasi pendidikan untuk siapasaja.* Aplikasi ini dilengkapi dengan narasi pendukung yangsangatbermanfaat bagi yang belum lancar membaca.* Zikir asmaul husna dengan music mp3.* Aplikasi dapat disimpan di memory external.* Terdapat juga MP3 Asmaul Husna iaitu 99 nama Allahuntukdifahami...Juga zikir harian Asmaul Husna untuk kita amalkan supaya kitasemuadalam kerahmatan ALLAH..INSYAALLAH.Aplikasi Religi Asmaul Husna berisi Lagu Religi Asmaul HusnaLaguMp3 dimana anda bisa mendengarkan kumpulan Full Lagu IslamiAsmaulHusna. Berikut ini adalah kami sajikan Kumpulan DownloadLaguReligi Asmaul Husna Terbaru yang menjadi sebuah rujukanpentinguntuk Anda semua.Kedepannya, kami akan selalu update konten. Semoga teman temansemuaselalu install aplikasinya agar kami selalu mendapat dukungandarisemuanya dalam mengembangkan aplikasi ini. Semoga Bermanfaatbuatsemuanya dan selamat menggunakan aplikasi Religi AsmaulHusnaterbaru ini dari perangkat Android Anda masing masing.Asma is an arabic word which means "Names", while "Husna" standsfor"Beautiful" so “Asmaul Husna” stands for Beautiful Names ofAllah.As given in the Quran:"The most beautiful names belong to Him (Allah)." (SurahAl-Hashr,verse 24).The Asma ul Husna awakens respect in servants towardAllah,connoting Allah's sublimity and transcendence. These names,whenused in dhikr - remembering Allah - and in supplication, leadtothe acceptance of prayers and result in the accumulation ofgooddeeds.Disclaimer :All of content in this application is not our trademark. We onlygetthe content from search engine and website. Please let me knowifyour original content want to remove from our application.Allah says inSurahAl-Araf verse 180:"Only God's Asmaa-ul Husna, then bermohonlah Him by callingAsmaa-ulHusna, and leave those who deviate from the truth in the(call)names him. Later they will reap the rewards of what they do"Learn the most beautiful names of Allah with Audio /Songstranslation and huraiannya. Among the best way to memorizethenames of God are with Audio / song.Listen to audio and help yourself and your children to memorizethenames of God are beautiful with the only applicationBeautiful Names are names either belong to Allah SWT. Inharfiyah,what it means is "good names". Beautiful Names refer tothe names,titles, designations, as well as attributes of Allah abeautifulanymore either.content:* Beautiful Names mean the most beautiful names of God asmentionedin the Qur'an, which eachhas the meaning of the definition / understanding of the good,nobleand beautiful.* The application comes with meaning, significance and fadillahofthe Divine Name.* Beautiful Names is an educational application for anyone.* This application is equipped with a supporting narrative thatisvery helpful to those who have read fluently.* Remembrance Divine Name with music mp3.* Applications can be stored in external memory.* There are also MP3 Asmaul Husna 99 names of Allah that is tobeunderstood ...Also the daily zikr amalkan Beautiful Names to us so that we areallin kerahmatan ALLAH..INSYAALLAH.Application Asmaul Husna Religion Religion contain songBeautifulNames Mp3 songs where you can listen to a collection ofFull SongsIslami Beautiful Names. Here is our present set ofReligious SongsDownload Latest Beautiful Names that become anessential referencefor all of you.Going forward, we will constantly update the content. We wishallthe friends always install the application so that we alwayshavethe support of all of them in developing thisapplication.Hopefully Helpful for everything and congratulationsuseapplications Religion Beautiful Names latest from yourAndroiddevice, respectively.Asthma is an arabic word roomates means "Names", while"Husna"stands for "Beautiful" so "Asmaul Husna" stands forBeautiful Namesof Allah. As given in the Quran:"The most beautiful names belong to Him (Allah)." (SurahAl-Hashr,verse 24).The Asma ul Husna awakens in Servants respect toward God,connotingGod's Sublimity and transcendence. Reviews These names,when usedin dhikr - remembering God - and in Supplication, lead totheacceptance of prayers and result in the accumulation ofgooddeeds.Disclaimer:All of the content in this application is not our trademark. Weonlyget the content from the search engines and websites. Pleaselet meknow if your original content want to remove fromourapplication.
Dangdut New Pallapa Terlengkap 1.4 APK
Dangdut New Pallapa Terlengkap adalah aplikasiyang berisi ratusan kumpulan lagu-lagu terkenal dari berbagai artisDangdut New Pallapa yang terbaru, lengkap dan terbaik. Padaaplikasi ini Anda bisa mendengarkan musik-musik dangdut terbaruselama yang anda inginkanDangdut Koplo Palapa Terbaru dapat Anda dapatkan melalui aplikasiini dimana Anda dengan secara mudah bisa menikmati sajian musikdangdut koplo terbaru khususnya dari Om Pallapa. Aplikasi mp3 lagudangdut Pallapa terbaru ini berisi kumpulan lagu dangdut koplopopuler 2016 dan 2017. Jika Anda sedang mencari aplikasi tepatseputar top lagu dangdut koplo 2016 dan 2017 lengkap maka iniadalah jawabannya. Yuk cek aplikasi lagu dangdut koplo terbaru,pastinya kumpulan bursa Dangdut Koplo Palapa Terbaru dalam aplikasibursa mp3 dangdut ini bisa kita putar dengan mudah melaluiperangkat Android kita masing masing.Aplikasi ini terinspirasi dari pengguna masyarakat indonesia yanghobi mendengarkan music Lagu Dangdut Koplo Terbaru, karenaacara-acara di televisi. Dangdut New Pallapa yang berikasikankoleksi lagu dangdut dari New Pallapa, yang di dedikasikan bagipecinta masic dangdut indonesia khususnya area jawa timur, di dalamaplkasi ini banyak sekali lagu lagu dangdut koplo yang di bawakanoleh Artis artis New Pallapa.Dengan lagu-lagu Dangdut New Pallapa 2017 pilihan seperti lagu dari: Rita Sugiarto, Ike Nurjanah, Wiwik Sagita, Anjar Agustine, LilinHerlina, Gerry Mahesa, Nadin Santoso, Tasya Rosmala, Brodin, DeviAldiva, Rena KDI, Jihan Audy, Risha Marsela, Salma Novita, AnisaRahma, Dwi Ratna, Ani Arlita, Elsa, Agus, Elis Santika, ViviRosalita, Arlida Putri, Lia Ladysta, Niken Ira, Riza Marsela, IutNuraini dan masih banyak lagi.Beberapa contoh lagu – lagu yang bisa anda dengarkan :Aku Rindu PadamuAku Seorang BiduanAku Tak Butuh CintaAmpunilahAnak Yang MalangAntara Senyum Dan PerangAsmaraBenang BiruBerdebar Hati BerdebarBerondong TuaBirunya CintaCatatan DustaCinta HitamCinta SegitigaCinta Yang SempurnaDalan AnyarDeritaDermaga CintaDiam Bukan Tak TahuDunia Milik BerduaEdan TurunGadis MalaysiaGita CintaGoyahHanya SatuHitamnya Duniamu Putihnya CintakuIming ImingJamu Pegel MlaratJanjiJaran GoyangJatuh CintaJumpa KangenKandasKanggo RikoKasih Dan SayangKatakan SayangKelanganKelayung LayungKelingan MantanKemarauKenanganKerinduanKimcil KepolenKonco MesraKugapai CintamuLoro Ora Penak Penak Ora LoroLuka Hati Luka DiriLukakuLungsetManjaMawar Ditangan Melati DipelukanMimpi TerindahMirasantikaNasibkuNelongsoNgelaliNyayian RinduOjo Nguber WelaseOleh OlehOplosanPengumpatPenontonPerawan KalimantanRambate RatahayuRangda TaiwanSecawan MaduSedingin SaljuSemua UntukmuSendiri SajaSeujung KukuTembang TresnoTembok DeritaDan masih banyak lagi ...Fitur yang ada: Play music selama yang anda inginkan dengan 1 kalitekan. Pause music. aplikasi ini berisikan kumpulan lagu dangdutnew pallapa yang berasal dari jawa timur, terdapat banyak artisdangdut new pallapa yang ada di alam aplikasi ini. Aplikasi inimembutuhkan koneksi internet yang cukup stabile. Semua videodangdut yang ada di dalam aplikasi tidak tersimpan di aplikasi,semua bersumber dari internet, jika ada yang pelanggaran yang tidakingin di tanyangkan dalam aplikasi ini bisa menghubungin contactdeveloper kami. aplikasi ini bertujuan untuk fans / penggemar musicdangdut koplo.Disclaimer : All of content in this application is not ourtrademark. We only get the content from search engine and website.The copyright of all content in this application is fully owned bythe creators, musicians and music labels are concerned. If you arethe copyright holder of the songs contained in this application andare not pleasing your song displayed, please contact us via emaildeveloper and tell us about the status of your ownership on thesong.Dangdut New PallapaComplete is an application that contains a collection of hundredsof famous songs from various artists dangdut New Pallapa current,complete and best. In this application, you can listen to thelatest music dangdut long as you wantDangdut Koplo New Palapa can you get through this application whereyou easily can enjoy the latest music dangdut especially from OmPallapa. Applications mp3 songs dangdut latest Pallapa Remixconsisted of songs popular in 2016 and 2017. If you're looking forthe right application around the top songs dangdut 2016 andcomplete in 2017 then this is the answer. Let's check the latestapplication dangdut song, certainly set the exchange Dangdut KoploNew Palapa in exchange mp3 dangdut this application we can playwith ease through our Android devices, respectively.This app is inspired by the Indonesian people who like listening tomusic Lagu Koplo Recent, because events on television. Dangdut NewPallapa that berikasikan collection of New Pallapa dangdut song,which is dedicated to lovers of Indonesian dangdut masic particulararea of East Java, in a lot of songs aplkasi dangdut songs thatbrought by the artist Artist New Pallapa.With songs Dangdut New Pallapa 2017 selection as songs from: RitaSugiarto, Ike Nurjanah, Mandy Sagita, Anjar Agustine, LilinHerlina, Gerry Mahesa, Nadin Santoso, Tasya Rosmala, Brodin, DeviAldiva, Rena KDI, Jihan Audy, Risha Marsela Salma Novita, AnisaRahma, Dwi Ratna Ani Arlita, Elsa, Agus, Elis Santika, ViviRosalita, Arlida daughter, Lia Ladysta, Niken Ira, Riza Marsela,IUT Nuraini and much more.Some examples of songs - songs that you can listen to:I miss youI'm A MusicianI do not need loveForgiveAnak Yang MalangBetween Smile And WarloveBlue threadHeart pounding poundingOld sugar daddyblue LoveNote LiesBlack LoveThe love trianglePerfect loveDalan AnyaranguishLove dockSilence is not Not KnowWorld Belong TogetherEdan TurunGadis MalaysiaGita CintaunsteadyOnly oneThe whiteness of the black Duniamu Cintakuenticing lureJamu Pegel MlaratPromiseJaran GoyangFall in lovebye KangenagroundKanggo RicoLove and affectiontell me dearKelanganKelayung LayungFormer KelinganDrymemoryLongingKimcil Kepolensidekick Mesrakugapai cintamuLoro Loro Ora Ora Penak PenakLuka Hati Luka YourselfLukakuLungsetSpoiledMawar Melati hands of dipelukanBeautiful dreammirasantikaMy fateNelongsoNgelalinyayian RinduOjo Nguber WelaseSouvenirsoplosanslandererspectatorvirgin BorneoRambate RatahayuRangda TaiwanCup of HoneyCold as SnowAll for youJust aloneNail tipsong Tresnowall DeritaAnd many more ...Existing features: Play music for as long as you want with one tap.Pause music. This application contains a collection of songsdangdut new pallapa originating from eastern Java, there are manynew dangdut artist pallapa that exist in nature this application.This app requires an internet connection that is quite stabile. Allvideo dangdut contained in the application are not stored in theapp, all sourced from the Internet, if there are violations thatare not wanted in tanyangkan in this application menghubungincontact our developers. This application aims to fans / fan dangdutmusic.Disclaimer: All of the content in this application is not ourtrademark. We only get the content from the search engines andwebsites. The copyright of all content in this application is fullyowned by the creators, musicians and music labels are concerned. Ifyou are the copyright holder of the songs contained in thisapplication and are not pleasing your song displayed, pleasecontact us via email developer and tell us about the status of yourownership on the song.
Kajian Ust Khalid Basalamah 1.2 APK
Satu aplikasi terbaru Kumpulan CeramahUst.Khalid Basalamah Lengkap bisa kita dapatkan melalui hp AndroidAndamasing masing dengan mudah, Kumpulan MP3 Khalid Basalamahdimanaaplikasi ini dibuat untuk mempermudah kita semua untukmempelajaridan tentunya hadir sebagai satu rujukan kajian agamaIslam seputarKajian Ust. Dr. Khalid Basalamah (Video dan MP3).Terkadang kitakesulitan mendapatkan Ceramah Ustadz Khalid BasalamahMp3 terbaru?Kesulitan untuk mendapatkan kumpulan tausiyah ustadzkhalidbasalamah mp3 saat ini? Berikut ini adalah kami sajikanPengajianDR Khalid Basalamah Terbaru yang menjadi sebuah rujukanpentinguntuk Anda semua. Melalui aplikasi Kumpulan CERAMAH Islamdan TanyaJawab Ust. Khalid Basalamah terbaru kita bisa mendapatkanbanyakilmu bermanfaat, selain itu dapat juga secara mudah untukdiputarmelalui perangkat Android Anda masing masing.Dalam aplikasi terdapat Kajian Islam, Ceramah dan Tanya Jawaboleh:DR Khalid Basalamah MA. Download Mp3 Pilihan terangkum secaramudahuntuk Anda pelajari sehari hari yang akan selalu terbarudanterupdate. Sebagai pelengkap kumpulan kajian Islam terlengkapAndamaka aplikasi ceramah ustadz khalid basalamah mp3 dalamsatuaplikasi ini bisa menjadi tambahan untuk kita pelajari danamalkan.Jangan sampai ketinggalan untuk mendapatkan Kumpulan SirohNabawioleh Ustadz Khalid Basalamah yang akan selalu update untukAndasemua, tentu saja Anda tidak akan pernah rugi untukmendownloadaplikasi Ceramah Ust Khalid Basalamah APK DownloadLengkap ini!!Tunggu apa lagi, segera download sekarang juga.Kedepannya, kami akan selalu update Kumpulan Ceramah Ust.KhalidBasalamah Lengkap. Semoga teman teman semua selaluinstallaplikasinya agar kami selalu mendapat dukungan dari semuanyadalammengembangkan aplikasi ini. Semoga Bermanfaat buat semuanyadanselamat menggunakan aplikasi Ceramah Ust. Khalid BasalamahLengkapini dari perangkat Android Anda masing masing. Terima kasihbanyakyah.“Rasulullah SAW bersabda :Barangsiapa yang mengajak/menunjukkan kepada seseorangsuatukebaikan, maka dia memperoleh pahala seperti pahala orangyangmengerjakannya, tanpa mengurangi sedikit pun daripahala-pahalamereka.”Beritahu teman Anda dan Support Kami dengan caramembagikannyakepada semua nya, Jazakumullah khairan katsiran.Disclaimer :All of content in this application is not our trademark. We onlygetthe content from search engine and website. Please let me knowifyour original content want to remove from our application.1. Mp3s & Video dimaksudkan untuk Keperluan Promosi Hanyadanmereka Sole Copyright Berpijak Dengan Masing-masing AudioMusicCompany mereka !2. Beli Asli CD & DVD untuk Mendukung Artis Favorit Anda!3. Aplikasi ini tidak pernah Host Mp3 & Video File!4. DISCLAIMER !!!! Aplikasi ini hanya menyediakan linkuntukmengakses video secara terorganisasi dan kami tidakbertanggungjawab atas masalah hak cipta sebagai aplikasi memberikanakses kevideo youtube dan link lainnya TERSEDIA ON PUBLICDOMAINOne set of thelatestapplications Ust Lectures. Khalid Complete Basalamah can getthatthrough your Android phone each with ease, set MP3 KhalidBasalamahwhere an application is made to facilitate all of us tolearn andcertainly comes as a reference study Study of Islam aroundthe Ust.Dr. Khalid Basalamah (Video and MP3). Sometimes we havetroublegetting Lecture Ustad Khalid Mp3 Basalamah latest? Thedifficultyto get a collection of tausiyah cleric khalid Basalamahmp3 today?Here is our present pengajians DR Khalid Recent Basalamahwhichbecame an important reference for you all. Through theapplicationof Islam and set TALKS FAQ Ust. Khalid latest Basalamahwe can geta lot of useful knowledge, but it can also be easy toplay throughyour Android device, respectively.In the app, Islamic Studies, Lecture and Q by: DR KhalidBasalamahMA. Download Mp3 summarized options are easy to learndaily thatwill always be the latest and updated. As a complementyou the mostcomplete collection of Islamic studies, the applicationof lecturescleric khalid Basalamah mp3 in one application can be anextra forus to learn and amalkan. Do not miss to get a set of SirohNabawiby Ustadz Khalid Basalamah that will always update for youall, ofcourse you will never lose to download Khalid BasalamahLecture UstAPK Download Complete this !! Wait no more, immediatelydownload itnow.Going forward, we will always update Ust set Lectures.CompleteBasalamah Khalid. We wish all the friends always installtheapplication so that we always have the support of all of themindeveloping this application. Hopefully Helpful for everythingandcongratulations using Ust Lecture applications. KhalidCompleteBasalamah this from your Android device, respectively.Thank youvery much well."Rasulullah SAW said:Whoever invites / show someone a kindness, then he gets arewardlike the reward of those who do, without reducing theslightestfrom their merits. "Tell your friends and Support We share it with all of hisways,Jazakumullah Khairan katsiran.Disclaimer:All of the content in this application is not our trademark. Weonlyget the content from the search engines and websites. Pleaselet meknow if your original content want to remove fromourapplication.1. Mp3s & Videos meant for Promotional Purposes Only andtheySole Copyright Rests With Each Audio Music Company them!2. Buy Original CDs & DVDs to Support YourFavoriteArtists!3. The application never Hosts Mp3 & Videos Files!4. DISCLAIMER !!!! This app only provides a link to the videoisorganized and we not responsible for copyright issues as theappprovides access to youtube videos and other links AVAILABLEONPUBLIC DOMAIN
Dangdut Remix Terlengkap 1.3 APK
Dangdut Remix Lengkap Terbaru dapatAndadapatkan melalui aplikasi ini dimana Anda dengan secara mudahbisamemperdengarkan Kumpulan Lagu Dangdut House Music RemixTerbaruLengkap. Aplikasi terbaru koleksi lagu Dangdut Remix NonstopDugemmp3 sebagai pilihan tepat untuk Anda yang tengah mencari FULLALBUMdangdut remix nonstop mp3. Jika Anda sedang mencari aplikasitepatseputar HITS LAGU DANGDUT REMIX INDONESIA TERBARU 2017,kumpulanlagu dangdut koplo remix & house music dugem full, makainiadalah jawabannya. Yuk cek aplikasi Dangdut Remix LengkapTerbaruNonStop ini yang mana bisa kita putar dengan mudahmelaluiperangkat Android kita masing masing.Aplikasi ini berisikan lagu-lagu Dugem Nonstop 2017 Dangdut RemixDjyang akan selalu update untuk Anda semua, tentunya anda tidakakanrugi untuk mendownload aplikasi Dangdut Remix Lengkap Terbaruini!tunggu apa lagi, download sekarang juga.Kedepannya, kami akan selalu update Dangdut Remix LengkapTerbaru.Semoga teman teman semua selalu install aplikasinya agarkamiselalu mendapat dukungan dari semuanya dalam mengembangkanaplikasiini. Semoga Bermanfaat buat semuanya dan selamatmenggunakanaplikasi Dangdut Remix Lengkap Terbaru ini dariperangkat AndroidAnda masing masing. Terima kasih banyak yah.Disclaimer :All of content in this application is not our trademark. We onlygetthe content from search engine and website. Please let me knowifyour original content want to remove from our application.1. Mp3s & Video dimaksudkan untuk Keperluan Promosi Hanyadanmereka Sole Copyright Berpijak Dengan Masing-masing AudioMusicCompany mereka !2. Beli Asli CD & DVD untuk Mendukung Artis Favorit Anda!3. Aplikasi ini tidak pernah Host Mp3 & Video File!4. DISCLAIMER !!!! Aplikasi ini hanya menyediakan linkuntukmengakses video secara terorganisasi dan kami tidakbertanggungjawab atas masalah hak cipta sebagai aplikasi memberikanakses kevideo YOUTUBE dan link lainnya TERSEDIA ON PUBLICDOMAINsepertiDangdut RemixRecentComplete can you get through this application where youeasily cansound set Lagu House Music Remix Newest Complete. Thelatest appcollection of songs Dangdut Remix Nonstop Dugem mp3 asthe rightchoice for you who are looking for FULL ALBUM nonstopdangdut remixmp3. If you're looking for the right application aboutHITSINDONESIA LATEST SONG REMIX DANGDUT 2017, a collection ofsongsdangdut remix full clubbing and house music, then this istheanswer. Come check Newest Complete application DangdutRemixNonStop these where we can play with ease through ourAndroiddevices, respectively.This application contains songs Dugem 2017 Nonstop Remix DangdutDjwill always update for you all, you certainly will not hurttodownload Dangdut Remix Latest Complete this! wait no more,downloadit now.Going forward, we will always update Dangdut Remix LatestComplete.We wish all the friends always install the application sothat wealways have the support of all of them in developingthisapplication. Hopefully Helpful for everything andcongratulationsuse applications Dangdut Remix Recent Complete thison your Androiddevice, respectively. Thank you very muchwell.Disclaimer:All of the content in this application is not our trademark. Weonlyget the content from the search engines and websites. Pleaselet meknow if your original content want to remove fromourapplication.1. Mp3s & Videos meant for Promotional Purposes Only andtheySole Copyright Rests With Each Audio Music Company them!2. Buy Original CDs & DVDs to Support YourFavoriteArtists!3. The application never Hosts Mp3 & Videos Files!4. DISCLAIMER !!!! This app only provides links to access thevideosin an organized way and we are not responsible for anycopyrightissues as the app gives access to YOUTUBE videos andother linksAVAILABLE ON PUBLIC DOMAIN as
7 Hari Hafal Surrah Ar-Rahman 1.4 APK
Al-Qur'an terdiri dari surat-suratyangditurunkan di dua kota, ada surat yang turun di Makkah, adajugasurat yang turun di Madinah saat Rasulullah SAW sudah berhijrahkeMadinah. Umumnya surat yang turun di Madinah memiliki banyakayatdan panjang, sedangkan surat-surat yang turun di Makkahcenderunglebih pendek dan lebih sedikit ayatnya.Surat Ar Rahman memiliki faedah dan keistimewaan yang luarbiasasebagai bagian dari Al Qur'an dimana mukjijat yang AllahSWTberikan kepada nabi besar Muhammad SAW ini telah memberikancahayakepada umat manusia di muka bumi ini.Bicara tentang anak-anak, bagi anda yang sedang mengajarkananakanda untuk menghafal surat-surat pendek, surat Ar-Rahman ataubagianda sendiri yang sedang mempelajari dan menghafal surat pendekdanSurat Ar-Rahman. Aplikasi ini menyediakan lantunan suratAr-Rahmankdari Qari Muzzamil Hasballah. Semoga bisa membantupengguna semuadalam belajar al Quran. Sangat mudah menggunakannyaselaindilengkapi dengan audio kumpulan ayat ini juga sangat nyamanuntukdi dengarkan.Kedepannya kita akan mencoba membuat versi aplikasi untukmurottalal quran surat pendek/ surat Ar-Rahman dari berbagaipenghafalquran seperti Ahmada Saud, Abu usamah, Imam AbdurrahmanAsSudais,Imam Maher AlMuaiqli, Imam Sa'd Al Ghamidi, Imam MisyariRashid,Muhammad Taha Al Junayd, H. Muammar ZA, MisharyrashidalafasySetelah masuk ke koleksi bisa langsung didengarkan kapanpunbahkantidak ada koneksi internet sekalipun.Akhir kata, kami mnegucapkan terima kasih telah menggunakanaplikasisurat Ar-Rahman ini, semoga kita semua di beri kekuataniman danislam agar senantiasa berbuat kebaikan dan selalubersyukur kepadaAllah SWT atas segala nikmat dan KaruniaNya.Selamat menggunakan aplikasi ringan surat Ar Rahman,semogabermanfaat.deskripsi lainSūrat ar-Raḥmān (Arabic: سورة الرحمن, "The Most Merciful") isthe55th sura of the Qur'an with 78 ayats.Imam Ja’far as-Sadiq (a.s.) has said that reciting this surahonFriday after the dawn prayers carries great reward. Surahas-Rahmanremoves hypocrisy from one’s heart.On the Day of Judgement, this surah will come in the shape ofahuman being who will be handsome and will have a very nicescent.Allah (s.w.t.) will then tell him to point out those peoplewhoused to recite this surah and he will name them. Then he willbeallowed to beg pardon for those whom he names and Allah(s.w.t.)will pardon them.The Imam (a.s.) also said that if a person dies after recitingthissurah, then is considered a martyr. Writing this surah andkeepingit makes all difficulties and problems vanish and also cureseyeailments. Writing it on the walls of a house keeps away alltypesof household pests. If recited at night, then Allah (s.w.t.)sendsan angel to guard the reciter until he wakes up and if recitedinthe daytime then an angel guards him until sunset.Disclaimer :All of content in this application is not our trademark. We onlygetthe content from search engine and website. Please let me knowifyour original content want to remove from our application.The Qur'an consists oftheletters was revealed in two cities, there is a letter whichfell inMakkah, there is also a letter which went down in Madinahwhen theProphet had emigrated to Madinah. Generally letter down inMadinahhas many verses and long, while the letters were dropped inMakkahtend to be shorter and less verse.Surat Ar Rahman has benefits and extraordinary privileges as partofthe miracle of the Qur'an where Allah Almighty gave to thisgreatprophet Muhammad SAW has given light to mankind on thisearth.Talk about the kids, for those of you who are teaching your childtomemorize short letters, letter of Ar-Rahman or for yourself whoisstudying and memorizing short letter and Surat Ar-Rahman.Thisapplication provides a letter Ar-Rahmank chanting of QariMuzzamilHasballah. Hope that helps users of all in learning theQuran. Itis easy to use in addition equipped with audio collectionof verseis also very comfortable to listen to.In the future we will try to make a version of the applicationformurottal al quran short letter / letter of Ar-RahmanQuranmemorizers from various such Ahmada Saud, Abu Usamah,ImamAbdurrahman AsSudais, Maher AlMuaiqli Imam, Imam Sa'd AlGhamidi,Misyari Imam Rashid, Muhammad Taha Al Junaid, H. MuammarZA, rashidMishary AlafasyUpon entry into the collection can directly be heard at anytimeeven though there is no internet connection.Finally, we mnegucapkan thank you for using the applicationletterAr-Rahman, may we all give the power of the Islamic faith andtoalways do what is good and always give thanks to God Almightyforall the blessings and His gift.Congratulations to use lightweight application letter Ar Rahman,maybe useful.other descriptionsSurat ar-Rahman (Arabic: سورة الرحمن, "The Most Merciful") isthe55th sura of the Qur'an with 78 ayats.Imam Ja'far as-Sadiq (a.s.) has said that reciting this surahonFriday after the dawn prayers carries great reward. Surahal-Rahmanremoves Hypocrisy from one's heart.On the Day of Judgment, this surah will come in the shape of ahumanbeing who will be handsome and will have a very nice scent.Allah(s.w.t.) will then tell him to point out Reviews those peoplewhoused to Recite this Surah and he will name them. Then he willbeallowed to beg pardon for Reviews those Whom he names andAllah(s.w.t.) will pardon them.The Imam (a.s.) Also said that if a person dies after recitingthissura, then is Considered a martyr. Writing this surah andkeepingit makes all Difficulties and problems vanish and Also cureseyeailments. Writing it on the walls of a house keeps away alltypesof household pests. If recited at night, then Allah (s.w.t.)sendsan angel to guard the Reciter until he wakes up and if recitedinthe daytime then an angel guards him until sunset.Disclaimer:All of the content in this application is not our trademark. Weonlyget the content from the search engines and websites. Pleaselet meknow if your original content want to remove fromourapplication.
Lagu Nasyid Terlengkap 2017 1.3 APK
Menjelang bulan suci Ramadhan dan harirayaIdul Fitri, marilah kita memperkuat iman dan takwa kitakepadaAllah Yang Maha Kuasa dengan mendengarkan lagu-lagureligiIslami.Kami lagu Islami aplikasi tanpa musik (الاناشيد السلامية بدونايقاعاو موسيقى 2017) berisi koleksi besar yang terbaik laguislami,Islam Nasheed, islamic Nasheed 2017, islamic Nasheed tanpamusik,Anachid islam, (اناشيد دينية, اناشيد اسلامية بدون ايقاع,اناشيداسلامية مؤثرة, Dinia anachid, anachid diniya) dan dibuatuntukmenggantikan lagu dengan musik Wich yang Haram.koleksi kami Islamia Anasheed berasal dari munishidinspalingterkenal di dunia Islam seperti:Anda akan menemukan lagu Islami "اغاني اسلامية 2017" yangberisikegembiraan, emosi, untuk memuji Allah), kami Nabi Muhammad(SWS)memungkinkan kita untuk memukul gendang pada malampernikahan.Anasheed tanpa instrumen yang digunakan di pestapernikahan(islamic Nasheed untuk pernikahan), upacara, ...dllBeberapa Islamique Nasyid:انشودة هزتني Hazatni, الهى انت تعلم كيف حالى, nasyid al burdaنشيدالبردة, mp3 للجوال, رحمن يارحمن مشاري العفاسي, عمر الفاروق,يسعدفؤادي كلما ذكر الحبيب ترنما, انا العبد, هزتني نسمات الليالي,الهيانت تعلم كيف حالي al 3afassi.Dalam App ini, terdapat lagu religi Islami terbaik dan terbaruyangbisa didengarkan secara streaming.Aplikasi ini berisi informasi mengenai lagu yang bernuansareligidan islami yang dibawakan oleh sekelompok penyanyi. Suarayang khasdan penampilan yang menarik membuat dia sangat disukaibanyakorang.Ini terbaik Islamic lagu & islamic Nasheed (Nasheedberperanislamic, lagu Nasyeed, islamic lagu anak-anak, arabicnasyid)berisi kebijaksanaan dan pengingat yang menghasut semangatmembelaagama, yang membangkitkan emosi Islam, untuk menangkalkejahatandan penyebabnya.Buru-buru untuk men-download yang terbaik Nachid dan Islamlagureligius (Anachid Dinia 2017 & Anachid Islamia) gratisislaminasyid.Dalam membuat aplikasi ini, Kami berharap kita semuadapatmenentramkan dan mendamaikan hati kita. Kedepannya, kamiakanselalu update informasi ini. Semoga teman teman semuaselaluinstall aplikasinya agar kami selalu mendapat dukungandarisemuanya dalam mengembangkan aplikasi ini. Terima kasihbanyakyah.aplikasi ini merangkum berbagai lagu islami nasyid menyentuhhatidan merupakan aplikasi dengan lagu islami terlengkapdanterbaik.lagu lagu islami ini merupakan lagu lagu pilihan terbaik yangsangatterkenal dalam masyarakat, biasanya di perdengarkan jika adahajattertentu. dengan adanya aplikasi ini teman teman bisamendengarkankapanpun, lagu lagu nya begitu indah dan merdu.juga di sertai lagu shalawat Nabi terindah dan merdusebagaipenyejuk hati.mp3 lagu islami dalam aplikasi ini begitu indah didengarkan,Fitur:● High quality sound,● 100% free songs,● Offline sholawat nabi,● The application can run in the background,● Easy to use interface,Disclaimer :All of content in this application is not our trademark. We onlygetthe content from search engine and website. Please let me knowifyour original content want to remove from our application.Before the holy monthofRamadan and Eid, let us strengthen our faith and piety toAllahAlmighty to listen to religious songs Islami.We songs Islami applications without music (الاناشيد السلاميةبدونايقاع او موسيقى 2017) contains a large collection of the bestsongsIslamic, Islamic Nasheed, Islamic Nasheed 2017, the IslamicNasheedwithout music, Anachid Islam, (اناشيد دينية, اناشيد اسلاميةبدونايقاع, اناشيد اسلامية مؤثرة , Dinia anachid, anachid diniya)andwas made to replace the song with music Wich is Haram.Our collection comes from munishidins Islamia Anasheed mostfamousin the Islamic world such as:You will find songs Islami "اغاني اسلامية 2017" which containtheexcitement, emotion, to praise God), our Prophet Muhammad(SWS)allowed us to beat the drum on the eve of the wedding.Anasheedwithout instruments used in the wedding party (IslamicNasheed fora wedding) ceremony, ... etc.Some Islamique Nasyid:انشودة هزتني Hazatni, الهى انت تعلم كيف حالى, nasyid al burdaنشيدالبردة, mp3 للجوال, رحمن يارحمن مشاري العفاسي, عمر الفاروق,يسعدفؤادي كلما ذكر الحبيب ترنما, انا العبد, هزتني نسمات الليالي,الهيانت تعلم كيف حالي al 3afassi.In this App, there are Islamic religious songs and the latestbestthat can be heard in streaming.This application contains information about the songs andIslamicreligious nuances delivered by a group of singers. The soundisdistinctive and attractive appearance make him verywellliked.It's best Islamic songs and Islamic Nasheed (Nasheed roleislamic,Nasyeed songs, children's songs islamic, arabic nasheed)containswisdom and a reminder that incite passion to defend thereligion,Islam evoke emotions, to ward off evil and itscauses.Rush to download the best Nachid and Islamic religioussongs(Anachid Dinia 2017 & Anachid Islamia) freeIslamicnasheed.In making this application, we hope we can pacify and reconcileallour hearts. Going forward, we will constantly updatethisinformation. We wish all the friends always install theapplicationso that we always have the support of all of them indevelopingthis application. Thank you very much well.This application summarizes the islami nasyid song touches theheartand is an application with a complete and best Islamicsongs.Islamic song song song song is the best option very well knowninthe community, usually perdengarkan if there is a specificintent.with this application, the friends can listen at any time,histheme song is so beautiful and melodious.also accompanied the Prophet shalawat loveliest songs andmelodiousas liver conditioning.mp3 song islami in this application is so beautiful tolistento,features:● High quality sound,● 100% free songs,● Offline sholawat prophet,● The application can run in the background,● Easy to use interface,Disclaimer:All of the content in this application is not our trademark. Weonlyget the content from the search engines and websites. Pleaselet meknow if your original content want to remove fromourapplication.
Similar Apps Show More...
Radio Dangdut Koplo 1.1 APK
Radio Dangdut Koplo adalah aplikasi Radio Streaming Dangdut KoploTerbaru dan Terupdate di Indonesia. Dengan aplikasi ini anda bisamendengarkan lagu dangdut kesayangan baik lagu dangdut terbarumaupun lagu dangdut lawas dari manapun dan kapanpun tanpa adabatasan wilayah siarannya. ada beberapa fitur dari aplikasi ini :1. Anda Bisa Set Waktu untuk aplikasi agar dapat sleep dengansendirinya 2. Anda Bisa Shuffle (Acak) Siaran secara otomatisSiaran Radio Yang Tersedia : Radio Dangdut 97.1 FM Republik DangdutRadio Soneta Suara Giri FM Surabaya Radio Pop Dangdut SemarangDahlia FM Bandung MBS FM Yogyakarta
RADIO DAN LAGU DANGDUT KOPLO 2.0 APK
Anda dapat menginstal Gratis Aplikasi ini,dandengarkan Radio dan Lagu Rhoma Irama New setiap saat.Koneksi 3g diperlukanRadio Dangdut KOPLO & CampursariRadio Dangdut Rhoma IramaAKU RAPOPOAKU MA APA ATUAIR MATA PERKAWINANAKU JADI KURUSANTARA TEMAN KASIHAKHIR SEBUAH CERITAAYO GOYANGANTARA SENYUM DAN PERANGAWAN KELABUBEKUBIARLAH MERANABIRUNYA CINTABAHTERA CINTABUNGA WARUNGBAPA MANABOJO BOJOANBOJO KETELUCINTA ABADICINTA TAK DIRESTUICUKUP SATU MENITCUMA KAMUDANGDUT JAMAIKADERITAMU ADALAH DOSAMUDOREMIDOA CINTADERITAMU DERITAKUEDAN TURUNGA PINTARGALA GALAGEBOY MUNJAIRGUE MAH GITU ORANGNYAGOYANG DOMANGHASRAT TERPENDAMHARI BERBANGKITISYARAT CINTAJAMAIKAJANDA MUDA BARUJAMU PEGEL MELARATKASIH SAYANGKELANGANKEBELETKARENA LIDAHKPKKOPI HITAMKELOASKEKASIHKELANGANKEJORAKUMINTA MAAFLAUT APILUKA HATI LUKA DIRIMAJU MUNDUR CANTIKMENDEM KANGENMAJU MUNDUR CANTIKMARAI CEMBURUMASA LALUMORENAMASIH ADAKAH CINTAMAHABARATA 1MAHABARATA 2MABOK JUDIMERIANGMINYAK WANGIMIMPINARAPIDANANYATAKANLAHNYIDAM PENTOLNYIDAM JEMBLENGOLEH OLEHOLEH OLEH 2PERAWAN KALIMANTAN.PERGI PAGI PLNG PAGIPERTEMUANPATAH HATIPERAWAN ATAU JANDAPUSING PALA BARBIERUMANGSAMU YO PENAKSATU AYATSUNSETSATU HATI ALLSAKITNYA TU DISINI 1SAKITNYA TU DISINI 2SENYUM DAN PERANGSEJENGKAL TANAHSELANGKUNG RONG LANGKUNGSENGSARASUNDASELIMUT TETANGGASATU HATISEPAROH ROGOSLALU RINDUTALINING ASMOROTAK MUNGKINTKWTERSISIHTUTUPE WIRANGTUTUPE WIRANG 2ULANG TAHUNUDUT DULUWEDHUSRadio Dangdut AcehRadio Dangdut JakartaRadio Dangdut PatiRadio Dangdut NegeriRadio Dangdut SurabayaYou can install thisFreeApplication, and listen to radio and Songs Rhoma Irama New atanytime.3g connection is requiredRadio Remix & CampursariRadio Dangdut Rhoma IramaI AM ALRIGHTMA ME WHAT ATUTEARS OF MARRIAGEI'M SO SKINNYLOVE AMONG FRIENDSTHE END OF STORYLET'S rOCKINGBETWEEN THE SMILE AND WARgray cloudsFROZENLET languishblue LOVEARK OF LOVEFLOWER SHOPWHERE IS FATHERBojo BOJOANBojo KETELUETERNAL LOVEUNBLESSED LOVEJUST ONE MINUTEONLY YOUDANGDUT JAMAICADERITAMU IS sinsDOREMIDOA LOVEDERITAMU DeritakuEDAN DOWNGA SMARTGALA GALAGeboy MUNJAIRGUE MAH so OrangnyarOCKING DOMANGlatent desireDay of ResurrectionCUE LOVEJAMAICANEW YOUNG WIDOWHerbal pegel destituteAFFECTIONKELANGANHAVE THE NEEDBECAUSE THE TONGUEKPKBLACK COFFEEKELOASLOVERKELANGANMorning StarI want SORRYblazeCUTS HEART PERSONAL INJURYGO BACK PRETTYmendem KANGENGO BACK PRETTYMarai JEALOUSPASTMORENAIS THERE STILL LOVEMahabharata 1Mahabharata 2Mabok gamblingfell dizzyPERFUMEDREAMPRISONERSDeclareNYIDAM bulbNYIDAM JEMBLENGSOUVENIRSBY BY 2VIRGIN Kalimantan.GO PLNG MORNING MORNINGMEETINGBROKEN HEARTVIRGIN WIDOW ORDIZZY PALA BARBIEYO RUMANGSAMU PENAKONE vERSESUNSETONE HEART ALLThe pain TU HERE 1The pain TU HERE 2SMILE AND WARpiece of landRONG SELANGKUNG LANGKUNGMISERABLESUNDANEIGHBOR'S BLANKETONE HEARThalf Rogopobud RINDUTALINING AsmoroIMPOSSIBLETKWLeft outTUTUPE WIRANGTUTUPE WIRANG 2BIRTHDAYFIRST UDUTwedhusRadio Dangdut AcehRadio Dangdut JakartaRadio Dangdut PatiRadio Dangdut StateRadio Dangdut Surabaya
Radio Indonesia 4.2 APK
Radio Indonesia brings you the best radiostations from Indonesia.With this app you will enjoy listening to online Indonesia radiobroadcasts and music on your android, no matter where you are. Bestof all, you get to access all this for free with RadioIndonesia!Features:* Save your favorite radio stations* Recent played radio stations* Quick searchAvailable radio stations:Prambors FM 102.2 JakartaDelta FM101 Jak FMNagaswara FM 99.7Gen FM 98.7FeMale Radio 97.9Dakwah SunnahElshinta JakartaHard Rock FM 87.6 - JakartaArdan FM 105.9103.1 Gen FM SurabayaRadio Swaragama 101.7Angling Darma FM - TulungagungRadio RodjaRadio MQFMRDI - Radio Dangdut Indonesia 97.1Radio Suara SurabayaRadio Bali - Menara FM 102.8Radio Pelita Kasih 96.3Radio CakrawalaAl-Hidayah FM 87.6 SoloGlobal FM Jakarta101.4 Trax FM88.6 Rhema FMPrambors FM 89.3 Surabaya99ers Radio 100.0Mustang 88 FMPrambors FM 95.8 JogjaHard Rock FM 87.7 - BandungRadio Fajri95.1 KIS FM JakartaPrambors FM 98.4 BandungRadio Syiar Sunnah 1440I-Radio JogjaEBS 105.9 FMHard Rock FM 87.8 - BaliRadio Salafy Indonesia (Rasyid)Prambors FM 105.1 MakassarIndika FMLite FM 105.8Radio Nafiri FMRadio Maria IndonesiaRadio Spirit TOC 107.7K-Lite FMSonora FM 92.0RRI Channel 5Smart FMRasil 720 (Radio Silaturahim)RPK FMRadio Suara Al-Iman 774Solo Radio 92.9KLCBS 100.4Radio Heartline Karawacibensradio 106.2Hard Rock FM 89.7 - SurabayaRadio Harbos FMCity Radio Medan 95.9Woman Radio 94.3Gajahmada FM 102.4Radio KosmonitaRadio Karanganyar Mendhut FM 87.9Radio DahliaSuzana 91.3Kiss 105 FM MedanMatrix FMGita Suara NusantaraCirebon Radio 89.2mtafm 107.9KaskusRadio - Radionya Anak IndoSindo Radio 104.6Global FM Bandungmost fmRRI Pro 2 JakartaLiiur FM Spirit StationRase FMPas FM 104.3Kencana FMMGT FM 101.1RRI Pro 3Radio MoraOZ Radio BandungRadio Mara 106.7 FM BandungV-Radio JakartaMQ RadioRadio HangRadio Heartline Samarinda 98.4Rasika FM SemarangCPS RADIORRI Pro 1 JakartaRRI Pro 4 JakartaI-Radio MakassarFBI FM 91.8Persada FM 92.4Radio SSKOZ Radio JakartaLiiur FM Spirit StationRamaClassy 103.4Radio Imelda FMRadio Al Muwahhidiin - Radio 3Sas Fm Surabaya 97.2Radio Heartline Bali FM 92.2VOI - Voice of Indonesia (RRI World Service)Radio Kita FM 94.3Banten Radio, Cilegon 95.3PR FM 107.5Radio Budi LuhurDakta Radio 107.0Batam FMTrijaya FM 87.6Elpas FM 103.6yes radioRadio Idola 92.6Rajawali bdg fmSCFM 104.7Sangkakala 1062Radio Al Muwahhidiin - Radio 2She Radio 99.6MRadio FM 98.8Rasika FM U.S.AMDC FM 100.5Marketeers RadioVolare FM 103.4Radio Rugeri 90.3ZooreformataElshaddai FM 91.3Radio BSushi FM 99.1Maestro FMardanGGLinkRadio KosmonitaMercury FMRadio Metro FemaleMy RadioRadio Star FM 105.5(null)Phoenix Radio BaliRADIO PRESTASIUFM FM 104.3cdbsBSP Radiounisi radio 104.5Ras FMRadio sijangAmanna FM 95.6Bali Niko PratamaStrato FM 101.9M Radio 102.7Radio ParantiModerato FMphoenixPhoenix Radio Bali 91.0Radio Arafah FMRetjo Buntung FM 99.4Sasando FMMotion Radio 97.5Madama MakassarRekan Gaya 97.4VOICollegerRadioPasfmRadio Al Muwahhidiin - Radio 1SbdGreen RadioVis FmAndini Radio 106.5RadioOn Bandung 94.8Ria Pop FMnasyidfmDhammaVijjaRaka 98.8 FMRadio Nayla 95.1SS FM 105.2Oxcy FM 107.5Rasika PekalonganJakarta DnB RadiosolaMega fm 103.20 bali indonesiaRama Radio 96.35MS Tri FM 104.2Colors Radio 87.7
Radio FM Indonesia 1.7 APK
Radio FM Indonesia All Stations is a mobile application that allowsits users to listen a bouquet of infotainment & Public Servicerendered in English, Indonesian, Mandarin and some major regionalIndonesia languages to cater to the intense media needs ofmobile-wielding listening public in Indonesia and abroad. It caresfor nostalgic Indonesian living far away from territories wheretheir mother tongue is spoken, folk-lore enjoyed and communicationidiom used as tool of effective expression. The app knitsIndonesians cutting across geographical boundaries. Say good bye tohead phones for playing radios on Phone. Here comes a new app inwhich you can play many radio channels via Internet. Just turn onyour Internet and Start enjoying flawless music on Indonesia RadioFor best results use 3G or Wifi This application doesnt playoffline radio Rajawali Radio - Bandung, Indonesia- Pop RadioSuka-Suka- Pop YIC Radio- Hit Radio - Rock/Top 40 Dj Wirya- PopSmart FM 95.9- Variety Radio IMSA- Islamic Ras 95.5 FM- Variety KISFM 95.1- Hits M Radio 98.8 FM- Pop MQFM 102.7 - Bandung Indonesia-Easy Listening 95.5 RASfm Jakarta- Easy Listening Radio Hang 106fm-Islamic Radio Suara Sorak Kemenangan / Radio REM- Christian 87.8Hard Rock Radio Bali- Variety Global Radio 88.4 FM- Variety V-RadioJakarta 106.6 FM- Variety Nagaswara 99.7 FM Bogor Radiotemen- PopLite FM - 105.8 Jakarta- Very Setya Online Streaming- World/FolkRadio Club Bali- Dance/DJ Radio Rodja- Islamic Radio Rodja -International- Islamic Radio Showtul Haromain FM- Islamicbaliradio- Variety KaskusRadio-Radionya anak Indo- Hits CilegonPass FM 105.2- Variety RJM 91.5 FM- Variety Radio Mora Jabar88.50FM- Talk I-Two Dangdut On- Dance/DJ MTA 107.9 Surakarta-Islamic Radio Komedi- Talk-Comedy Win FM 95.7 Bogor- Pop ITCFBStreaming Radio- Talk AL HIDAYAH FM SOLO- Islamic Radio DangdutIndonesia 97.1 FM- Variety IRS Network- Rock-Heavy Metal NagaswaraFM Radiotemen- Pop Retjo Buntung Yogyakarta- Variety NRS Radio-Variety SKY CYBER SOMEPUNK- Dance/DJ Geronimo 106.1 FM Jogja-Rock-Alternative blissfullove2013 Radio- Hits Sarkub FM ASWAJA-Islamic K-Lite FM Bandung- Hits MiXXXiN Radio- Pop 90.7 UTY FMMedari- Hits Radio VIS FM 101.5- Hits PAZZ 19 RADIO INDRAMAYU- PopSerambi FM 90.2 MHz- Easy Listening Cybersky Online Radio- PopPrambors FM - 98.4 FM (Bandung)- Hits Prambors FM - 105.1 FM(Makasar)- Hits Prambors FM - 89.3 FM (Surabaya)- Hits Radio PPIDunia- Public Radio RRI World Service - Voice Of Indonesia- PublicRadio 987 Gen FM- Hit Radio - Rock/Top 40 101 Jak FM- Radio Sarkub-Islamic Radio NU - Suara Nahdlatul Ulama- Islamic Aswaja FM -Ponorogo- Islamic EBS 105.9 FM - Surabaya- Variety Istara 101.1 FM- Surabaya- Variety Suara Surabaya 100.0 FM- Variety RadioMuhammadiyah- Islamic Delta FM 99.1- Variety Boss FM 102.8 PematangSiantar- Pop 105.9 FM Ardan Radio- Hits J Radio 91.7 FM- Hits MGT101.1 FM Bandung- Hit Radio - Rock/Top 40 Radio Sonora Surabaya97.75 FM- Variety Radio Rhema 88.6 FM Semarang- Christian Radio ElShaddai FM 91.30 MHz, Surakarta- Christian Radio Suara Gratia 95.9FM Cirebon- Christian Radio Harmoni FM Blitar- Christian RadioSonora FM 92.0 Jakarta- Public Radio Radio Cakrawala 98.3 FMJakarta- Musicals Prambors FM - 102.2 FM Jakarta- Hits RPK FM 96.3Radio Pelita Kasih Jakarta- Christian Radio Maria Indonesia 104.2FM- Christian Radio Sangkakala AM 1062 KHz Surabaya-Christian-Gospel Radio [Live] Bethany 92.9 FM Surabaya-Christian-Gospel Cosmopolitan 90.4 FM Jakarta- Pop Nafiri 107.1 FMSurabaya- Christian Camajaya 102.6 FM Jakarta- Variety SindoTrijaya 104.6 FM Jakarta- Talk-News Radio Heartline Karawaci 100.6FM- Variety Radio Volare 103.4 FM Pontianak- Variety SIPP FeMale105.8 FM Padang- Pop FeMale Radio FM 97.9 Jakarta- Pop Women Radio94.3 FM Jakarta- Variety Elshinta News & Talk 90.0 FM Jakarta-Talk-News Pas FM 92.4 MHz Jakarta- Talk-News Dengerin MusikIndonesia- Variety GOOD NEWS FM 94.9 Semarang- Variety andmore.......
Radio Dangdut Indonesia 1.4.6 APK
Radio terbaik Dangdut Indonesiaonlinestreaming paling asik digoyang.Radio dangdut live indonesia best radio dangdut.Radio listen radio online indonesia.Radio dangdut indonesia streaming.Best Radio Dangdut Indonesia Live music dang dut.Denger Musik Dangdut Indonesia Live untuk android anda.Bisa denger Radio Dangdut dimana saja dan kapan saja.Kamu bisa denger lagu - lagu dangdut music terbaru.
Music & Audio Top Show More...
ViNyL Music Player 1.2.9 APK
The Top Music Player for Android. is amusthave music player for smart phones.Built-in powerful Bass Booster and Equalier, Quick scan allmusicfiles and The New Interactive Experience you have never hadbefore.HD Vinyl Playback, Over 10 gorgeous background skins to makeyourmusic player look more outstanding.And more than 3 desktop widgets make your music play never beensoeasy.Free to get this best music player pro.,b>Key Features:- Browse and play your music quickly by albums, artists,songs,playlists, and folders- HD Vinyl Playback style- 10 beautiful default skins or custom with your own photos- High quality decoding with mp3,mp4/m4a,wma,flac and ape- 3 home screen WIDGETS(4*1, 2*2, 4*1)- Music Library wide search. Find all your music never beensoeasy.- Audio Recorder- Sleep mode- Lock screen support.- Five band graphic equalizer and Bass Booster- 10 types of pre-set music one for you choice, or you canmanuallyadjust the equalizer- Lyric support, Automatic scanning all the lyric files ,andmatching the most appropriate lyrics file for your songs.- Headset support. Support one button and multiple buttonsheadsets.Leave your device in the pocket!- Notification STATUS support: display album artwork, titleandartist, play/pause, skip forward and stop CONTROLS innotificationstatus.To learn more about the advanced settings, please feel free todownand have a try. You won't be disappointed.
القران الكريم الحصري بدون نت 1.0 APK
تلاوة القران الكريم بصوت الشيخمحمودخليلالحصريبدون انترنتتلاوة عذبة ونقية للقارئ الشيخ محمود خليل الحصريلاتحتاج للاتصال بالانترنتقراءة الية للسور دون الحاجة للتدخل منك , امكانية اعاداةتلاوةالسورمناجل الحفظتشغيل تلاوة السور حتى لو كان الجهاز مغلقاارجو ان تنسونا من خالص دعاؤكم و لاتنسوامشاركةالتطبيقمعاصدقائكمQuranrecitationbySheikhMahmoud Khalil exclusive without InternetSolemn fresh and pure the reader,SheikhMahmoudKhalilexclusiveDo not need to connect to the InternetRead the mechanism of the wall without the needforinterventionfromyou, the possibility of Aadah recitationfenceforconservationRun recitation of the fence, even if the device isswitchedoffI hope that you forget the sincere prayers and not forgettosharetheapplication with your friends
Emma for Spotify (TV) 1.00 APK
*** Spotify PremiumAccountisnecessary***Info that Emma will shut down on Jan 28, 2017.All + features are free starting from now (November 2016)***************************************************You need a Spotify Premium Account to use this software.- Access to top playlists (Top 100, Viral, Pop, Rock, etc.)- Access to New Releases, New Albums and Featured PlayLists- Play album, top songs, start radio, play any Playlistviavoicecommand- save songs to your Library & follow playlists.***If this app does not work for you, don't buy the+version,because it will not solve the problem*** Some userhaveproblemsusing it on Sony Bravia TVswith Emma for Spotify+ you will get:- more Categories, more Featured Playlists, Recent Playlists- MyLibrary screen with your Songs, Artists,AlbumsandPlaylistsincl. features to remove tracks from Libraryandunfollowplaylists.- Shortcuts on mediaplayer screen (Play Artist TopSongs,StartArtist Radio, Play full Album, Save Tracks)- a feature to add tracks to your own playlists.Examples for Voice Commands:Systemwide Voice Commands like "Play Coldplay" or"PlayMyloXyloto"In App-Voice Commands:- "Play Coldplay" plays Top Songs from Coldplay- "Album Coldplay Live 2012" plays specific Album- "Radio Coldplay" starts radio based on similar Artists- "Playlist Chill Out" plays a playlist named chill out- "Dance Music" or "Chill Out" searches andshowsspecificplaylists.This app is designed to work on AndroidTV!This app uses the official spotify beta sdkforandroid(https://developer.spotify.com/technologies/spotify-android-sdk)butisnot endorsed, certified or otherwise approved in any waybySpotify.Spotify is the registered trade mark of theSpotifyGroup.
Cat Sounds Ringtones 2.0 APK
Cat Sounds Ringtones is a brand newappthatbrings all the best cat sounds to your phone! All youcatloversout there are going to be so pleased with this greatapp.CatSounds is a collection of most adorable cat noises,kittysoundsand cat meowing sounds. You will find every possiblesoundthatyour favorite animal makes right here! You can choose fromarichselection of all natural cat sounds and set your favoritesoundasa ringtone, SMS notification or alarm sound. Wake upeverymorningwith your phone purring just like a real cat does!DownloadCatSounds Ringtones for free now and turn your smartphoneintomeowingcat![ Features ]- Hold the play button to set sound as ringtone,notificationsound(SMS/email) or alarm.- Assign as ringtone to specific contact in your contactlist.- Easy to use UI, Cat Sounds Ringtones works inlandscapeandportrait mode, optimized for all tablets andsmartphones.- Most popular cat sounds on the market!Kids are the biggest animal lovers and they are goingtoadorethese cat sounds! They will have so much fun hearingthesebestringtones. You will put a smile on their face every timeyouplay afunny cat sound. You will be surprised how much joythesecatsounds can bring. Browse through an extensive selectionofvariouslovely free ringtones. Pick your favorite free soundfromthis catsound effects soundboard and set it as a SMSalertnotification,chat notification, ringtone or alarm sound!Download“Cat SoundsRingtones” and enjoy them with your family!It’s time to turn your phone into your favorite animal!Youwillbe the center of attention whenever your phone makes asound.Alltrue cat lovers are going to be thrilled when they hearyourphoneringing. Share Cat Sounds Ringtones with your friendswhoadorecats! They are going to be most thankful and willappreciateyoufor discovering and sharing these cool ringtones withthem.CatSounds Ringtones is the best collection of topringtones,meowingSMS notification sounds and purring alarm tones.Bedelightedwhenever your phone meows! Download Cat SoundsRingtonesfor freenow.Feel free to contact us for any questions or feedback.
Best Car Sounds 2.1 APK
Best Car Sounds delivers theultimateexperiencewhen it comes to expensive and high-quality, topnotchvehiclesounds. This new app is bringing you the bestcollection ofthehottest incoming call alert melodies, SMSnotification soundsandloud alarm tones. Car lovers will startloving their favoritecarseven more because of these realistic andloud engine sounds.Yourmobile phone will sound so cool, like neverbefore, and yourheartwill beat faster when you hear that thrillingsound ofengineignition or the sound of tires screeching onasphalt. DownloadBestCar Sounds for free now and start your race!- Best new futuristic ringtones & SMS sounds!- Set as ringtone, notification sound (SMS/email) or alarm.- Assign as ringtone to specific contact in your contactlist.- Easy to use UI, Best Car Sounds App works in landscapeandportraitmode.Best Car Sounds is the newest most popular app foryoursmartphone!Assign different tunes for each contact and enjoythesepowerfulblasting sounds on daily basis. It is a loud andamusingway to getthe best out of every phone call or SMS you getand todraweveryone`s attention. Get your daily dose of adrenalinewiththesecrazy new roaring ringtones right now! If you feel theneedforspeed, these ringtones will awaken the passion in you andyouwillbe under the impression that you’re racing with anothercarthat isspeeding up right next to you. Go “fast and furious”withBest CarSounds! Anyone with passion for fast cars andpowerfulvehicleswill go crazy about these ringtones.Feel free to contact us for any questions or feedback.
Amex UNSTAGED: Taylor Swift 1.2.0 APK
Step inside acinematicinteractivemusicalexperience starring Taylor Swift. Choosewhereyou go, whoyoufollow and what you explore in a stunninghousefilledwithcharacters, objects and scenes.Shot with groundbreaking 360° cameras and scored witharichaudiosoundtrack based on Taylor’s single ‘Blank Space’fromhernew album1989, the experience is an immersivejourneywithintertwinedstorylines, multiple rooms and dozensofhiddeninteractive featureswaiting to be unlocked andexplored.The app also features the original ‘Blank Space’musicvideo,1989album purchase details and tour ticketinginformation.You canalsoexplore exclusive behind the scenes footagefrom theTaylorSwiftshoot, as well as the archive of Amex UNSTAGEDliveeventsand filmswith other top artists.The American Express UNSTAGED app is intended for ages 13+.
Lagu Natal 2017 1.2 APK
Natal (dari bahasa Portugisyangberarti"kelahiran") adalah hari raya umat Kristen yangdiperingatisetiaptahun oleh umat Kristiani pada tanggal 25Desemberuntukmemperingati hari kelahiran Yesus Kristus. Nataldirayakandalamkebaktian malam pada tanggal 24 Desember; dankebaktianpagitanggal 25 Desember. Beberapa gereja Ortodoksmerayakan Natalpadatanggal 6 Januari (lihat pula Epifani).Dalam tradisi barat, peringatan Natal jugamengandungaspeknon-agamawi. Beberapa tradisi Natal yang berasaldari Baratantaralain adalah pohon Natal, kartu Natal, bertukarhadiah antaratemandan anggota keluarga serta kisah tentang SantaKlausatauSinterklas.Kata “natal” berasal dari ungkapan bahasa Latin DiesNatalis(HariLahir).Dalam bahasa Inggris perayaan Natal disebutChristmas,dariistilah Inggris kuno Cristes Maesse (1038) atauCristes-messe(1131),yang berarti Misa Kristus. Christmas biasapula ditulisΧ'mas, suatupenyingkatan yang cocok dengan tradisiKristen, karenahuruf X dalambahasa Yunani merupakan singkatan dariKristus ataudalam bahasaYunani Chi-Rho.Untuk menyambut natal dan tahun baru, makakamimengembangkansebuah aplikasi yang berisi kumpulan lagu-laguNatalyang populerbaik di Indonesia maupun Dunia, adapun lagu-lagunatalyang kamisajikan pun cukup lengkap, antara lain :♦ Jingle Bells♦ We Wish You Merry Christmas♦ Selamat Hari Natal dan Tahun Baru♦ Telah Datang♦ Kita Rayakan Hari Natal♦ Oh Holy Night♦ Malam Sunyi Senyap♦ Sebab Dia Lahir Bagi Kita♦ Christmas is Here♦ Angel We have heard on High♦ Malam Kudus♦ Gita Surga Bergema♦ Hai Mari berhimpun♦ The first Noel♦ Twelve days of Christmas♦ Oh come little children♦ Hark the herald angels sing♦ Natal Pertama♦ dllFitur :♦ Bisa dijadikan ringtone hp♦ Bisa dijadikan alarm♦ Bisa dijadikan nada notifikasi♦ Tidak membutuhkan koneksi internet♦ Sudah menerapkan android 7♦ Aplikasi GratisSemoga dengan hadirnya aplikasi Lagu Natal 2017inibermanfaatbagi anda yang merayakan, jangan lupa ratedanreviewnya!!Christmas(fromPortuguesemeaning "birth") is a Christian holiday whichiscelebrated annuallyby Christians on December 25 to commemoratethebirth of JesusChrist. Christmas is celebrated in theeveningservice on December24; and service in the morning ofDecember 25.Some Orthodoxchurches celebrate Christmas on 6 January(see alsoEpiphany).In the western tradition, Christmas warningalsocontainsnon-religious aspects. Some Christmas traditions fromtheWestinclude Christmas trees, Christmas cards, exchanginggiftsbetweenfriends and family members as well as the story ofSantaClaus orSanta Claus.The word "Christmas" comes from the LatinphraseAnniversary(Birthday) .In English Christmas celebrationcalledChristmas, fromthe old English term Cristes Maesse (1038)orCristes-messe (1131),which means Mass of Christ. Christmasusuallyalso written Χ'mas, ashortening that fits with theChristiantradition, because theletter X in Greek is an abbreviationof theChrist or the GreekChi-Rho.To welcome Christmas and new year, we developedanapplicationthat contains a collection of Christmas songsarepopular inIndonesia and the World, while the Christmas songsthatwe serve isquite complete, among others:♦ Jingle Bells♦ We Wish You a Merry Christmas♦ Merry Christmas and Happy New Year♦ Has Come♦ We Celebrate Christmas♦ Oh Holy Night♦ Silent Night Silent♦ Because He is Born for Us♦ Christmas is Here♦ Angel We Have Heard on High♦ Holy Night♦ Gita Heaven Bergema♦ Hi Mari rally♦ The first Noel♦ Twelve days of Christmas♦ Oh come little children♦ Hark the herald angels sing♦ First Christmas♦ etc.Features:♦ Can be used as a ringtone hp♦ Can be used as alarm♦ Can be used as a notification tone♦ Does not require an internet connection♦ Already applying android 7♦ Free AppsHopefully with the presence of a Christmassong2017application is beneficial for those who celebrate, donotforgetrate and the review !!