![Fruit Crush Game 1.1 Fruit Crush Game 1.1](https://cdn.apk-cloud.com/detail/image/com.mobilegame.fruitcrush-w130.png?r2)
Description
App Information Fruit Crush Game
- App NameFruit Crush Game
- Package Namecom.mobilegame.fruitcrush
- UpdatedDecember 28, 2015
- File SizeUndefined
- Requires AndroidAndroid 2.2 and up
- Version1.1
- DeveloperGame Edukasi Anak
- Installs50 - 100
- PriceFree
- CategoryPuzzle
- DeveloperEmail [email protected]Sumber - Cirebon
- Google Play Link
Game Edukasi Anak Show More...
Tebak Gambar Suka-suka 1.0 APK
Game Tebak Gambar Suka-suka merupakanpermainan menebak 30 gambar benda di sekitar kita yang dirangkaidalam 2,3 atau 4 bentuk gambar. Pemain dituntut untuk menggunakanimajinasi, wawasan dan pengetahuannya untuk menebak kata darigambar tersebut. Jawab dengan teliti setiap gambar yang muncul.Aplikasi Game Tebak Gambar ini sangat cocok bagi kamu yang ingintantangan dan mengasah otak kamu lewat logika.Jika benar dalam menebak akan ada penambahan koin, jika salahakan ada pengurangan koin. Kamu tidak akan bisa ke levelselanjutnya jika tebakan kamu salah, kamu bisa lanjut sampaitebakan kamu benar.Ada 3 pilihan bantuan:1. Menghilangkan 3 huruf, dikurangi 40 koin.2. Membuka 1 huruf lainnya, dikurangi 25 koin.3. Membuka huruf pertama, dikurangi 10 koin.Mudah bukan? ayo kumpulkan sebanyak-banyaknya koin!Hak Cipta:Sebagian besar gambar pada Game Tebak Gambar ini diambil dari situsPixabay (http://pixabay.com) dan berlisensi CC0 1.0Universal / Public Domain Dedication (bebas pakai).Jika ada hal-hal yang tidak berkenan dalam Game Tebak Gambarini, silahkan hubungi kami.Jangan lupa untuk memberi komentar maupun rate untuk aplikasiini.Terima kasihSemoga bermanfaatGame Guess PictureLove-love is a guessing game 30 images of objects around us arearranged in 2,3 or 4 form an image. Players are required to useimagination, insight and knowledge to guess the word from theimage. Replied carefully every picture that appears. ApplicationsGame Guess This image is suitable for you who want to challenge andsharpen your brain through logic.If correct in guessing there will be the addition of the coin,if there will be a reduction of one coin. You will not be able tonext level if you guess wrong, you can go until you guessright.There are 3 options for help:1. Eliminate 3 letter, minus 40 coins.2. Open one other letter, minus 25 coins.3. Open the first letter, minus 10 coins.Easy is not it? Let's collect as many coins!Copyright:Most of the images in the game Guess This picture was taken fromthe site Pixabay (http://pixabay.com) and licensed cc0 1.0Universal / Public Domain Dedication (free to use).If there are things that are not pleasing in Game Guess thispicture, please contact us.Do not forget to comment and rate for this application.Thank youHope it is useful
Tebak Mata Hewan 1.0 APK
Tebak Mata Hewan merupakan permainan menjawab 30 matahewan/binatang. Permainan ini mengasah kemampuan anak dalammengenal hewan/binatang.Cara Main:Disetiap level akan muncul gambar mata hewan, kamu diminta menjawabnama hewannya (1 kata), pastikan jawaban kamu benar.Jika kamu benar dalam menebak akan ada penambahan koin, jikasalah akan ada pengurangan koin. Kamu tidak akan bisa ke levelselanjutnya jika tebakan kamu salah, kamu bisa lanjut sampaitebakan kamu benar.Ada 3 pilihan bantuan:1. Menghilangkan 3 huruf, dikurangi 40 poin2. Membuka 1 huruf lainnya, dikurangi 25 poin2. Membuka huruf pertama, dikurangi 10 poinHak Cipta:Gambar-gambar pada game Tebak Mata Hewan ini sebagian besar diambildari situs Pixabay (http://pixabay) dan berlisensi CC0 1.0Universal / Public Domain Dedication (bebas pakai).Jika ada hal-hal yang tidak berkenan dalam permainan Tebak MataHewan ini, silahkan hubungi kami.Jangan lupa untuk memberi komentar maupun rate untuk aplikasiini.Terima kasihSemoga bermanfaatGuess theAnimal Eye is answered 30 eye game animals / animal. These gameshone children's ability to recognize the animal / animals.How to Play:Each level will appear eye images of animals, you are asked toanswer the name of the animal (one word), make sure you answercorrectly.If you are correct in guessing there will be the addition of thecoin, if there will be a reduction of one coin. You will not beable to next level if you guess wrong, you can go until you guessright.There are 3 options for help:1. Eliminate 3 letter, deducted 40 points2. Open one other letter, minus 25 points2. Open the first letter, deducted 10 pointsCopyright:The pictures on the game Guess the Animal Eye is mostly taken fromPixabay website (http: // pixabay) and licensed cc0 1.0 Universal /Public Domain Dedication (free to use).If there are things that are not pleasing in the game Guess ThisAnimal Eye, please contact us.Do not forget to comment and rate for this application.ThanksHope it is useful
Logo Provinsi Quiz 1.0 APK
Logo Provinsi Quiz merupakan permainan menebak 34 logo provinsiyang ada di Indonesia. Quiz ini bertujuan untuk mengukur seberapajauh pengetahuan anak-anak tentang (logo) provinsi yang ada diIndonesia.Jika benar dalam menebak akan ada penambahan koin (+15), jikasalah akan ada pengurangan koin (-5). Kamu hanya boleh melakukan 3kesalahan dalam menebak (hanya punya 3 'nyawa'),jika lebih makaakan kembali ke awal mula permainan. Mudah bukan? ayo kumpulkansebanyak-banyaknya koin! Buktikan bahwa kamu cinta tanah airIndonesia!Bahan pertanyaan disarikan dari berbagai sumber terpercaya. Jikaterdapat kekeliruan atau ketidakakuratan, mohon sekiranya untukmenginformasikan kepada kami.Jangan lupa untuk memberi komentar maupun rate untuk aplikasiini.Terima kasihSemoga bermanfaatProvinceLogo Quiz is a guessing game logo 34 provinces in Indonesia. Quizaims to measure how far the children's knowledge about (logo)provinces in Indonesia.If correct in guessing there will be additional coin (+15), ifthere would be a reduction of one coin (-5). You can only do 3errors in guessing (only has 3 'lives'), if it is then it will goback to the beginning of the game. Easy is not it? Let's collect asmany coins! Prove that you love the homeland Indonesia!Material abstracted questions from various reliable sources. Ifthere are mistakes or inaccuracies, please if it were to informus.Do not forget to comment and rate for this application.Thank youHope it is useful
Lagu Daerah Nusantara 1.1 APK
Lagu Daerah Nusantara merupakan aplikasi kumpulan lagu daerah darisetiap Propinsi di Indonesia. Aplikasi ini cocok sebagai bahanpembelajaran anak Playgroup, PAUD, TK, maupun SD dalam mengenalLagu-Lagu Daerah di Nusantara sehingga muncul rasa cinta dan banggaterhadap budaya tanah airnya. Kelebihan aplikasi ini: - Menu yangsimpel dan menarik - Penggunaan yang mudah - Suara yang jernihdisertai lirik - 100% gratis Adapun Lagu Daerah Nusantara padaaplikasi ini, antara lain: 1.Ampar Ampar Pisang 2.Anak Kambing Saya3.Anju Ahu 4.Apuse 5.Ayam Den Lapeh 6.Batanghari 7.Bolelebo8.Bungong Jeumpa 9.Cing Cang Keling 10.Cublak Cublak Suweng 11.DewaAyu 12.Hela Rotan 13.Huhatee 14.Injit Injit Semut 15.Lembe Lembe16.Mande Mande 17.Mariam Tomong 18.O Ina Ni Keke 19.O Ulate 20.RekAyo Rek 21.Sansaro 22.Saputangan Babuncu Ampat 23.Sarinade24.Seringgit Dua Kupang 25.Si Patokan 26.Soleram 27.Suwe Ora Jamu28.Tanase 29.Tokecang 30.Yamko Rambe Yamko Hak Cipta: Lirik danlagu pada aplikasi ini merupakan hak cipta dari pencipta, penyanyi,maupun label rekamannya. Jika ada kesalahan lirik dan lagu, jikaada hal-hal yang tidak berkenan dalam aplikasi Lagu DaerahNusantara ini, silahkan hubungi kami. Jangan lupa untuk memberikomentar positif, share maupun rate bintang lima untuk aplikasiini, agar kami bisa mengembangkan dengan lebih baik. Terima kasihSemoga bermanfaat
Fruit Crush Game 1.1 APK
Ayo mainkan Fruit Crush Game danrasakankeseruan permainannya..!Fitur :3 Mode Game :- Time Attack- Classic Mode- New ModeDengan 30+ Level yang akan selalu di updateCara Main:- Cocokan tiga buah-buahan yang sama dengan cara menggesernya- Untuk naik level (atau mendapatkan tiga bintang) harusmencapaiskor yang telah ditentukan disetiap levelnyaAyo dukung Fruit Crush Game dengan memberikan Rate, Share&Komentar..Terima kasihLet's play FruitCrushgame and feel the excitement of the game ..!Features:3 Game Modes:- Time Attack- Classic Mode- New ModeWith Level 30+ will always be updatedHow to Play:- Match three fruits together by sliding- To level up (or get three stars) should reach apredeterminedscore in every levelCome support Fruit Crush game by giving Rate, Share &Comment..thank you
Tebak Icon Negara 1.0 APK
Tebak Icon Negara merupakan permainan menjawab 20 pertanyaan yangberupa icon/landmark suatu negara.Icon tersebut menjadi ciri khasnegara yang dimaksud. Permainan ini mengasah kemampuan anak dalammengenal icon di sebuah negara.Cara Main:Disetiap level akan muncul gambar yang berisi bangunan yg merupakanicon negara, kamu diminta menjawab negara mana yang memiliki icontersebut, pastikan jawaban kamu benar.Jika kamu benar dalam menebak akan ada penambahan koin, jikasalah akan ada pengurangan koin. Kamu tidak akan bisa ke levelselanjutnya jika tebakan kamu salah, kamu bisa lanjut sampaitebakan kamu benar.Ada 3 pilihan bantuan:1. Menghilangkan 3 huruf, dikurangi 40 poin2. Membuka 1 huruf lainnya, dikurangi 25 poin2. Membuka huruf pertama, dikurangi 10 poinHak Cipta:Gambar-gambar pada game Tebak Icon Negara ini sebagian besardiambil dari situs Pixabay (http://pixabay) dan berlisensi CC0 1.0Universal / Public Domain Dedication (bebas pakai).Jika ada hal-hal yang tidak berkenan dalam permainan Tebak IconNegara ini, silahkan hubungi kami.Jangan lupa untuk memberi komentar maupun rate untuk aplikasiini.Terima kasihSemoga bermanfaatState IconGuess the game to answer 20 questions in the form of icons /landmarks such negara.Icon become a hallmark of the country inquestion. These games hone children's ability to recognize the iconin a country. How to Play:In each level the image will appear that contains the building thatis an icon of the country, you are asked to answer which countrieshave the icon, make sure you answer correctly.If you are correct in guessing there will be the addition of thecoin, if there will be a reduction of one coin. You will not beable to the next level if you guess wrong, you can go until youguess right.There are 3 options for help:1. Eliminate 3 letter, deducted 40 points2. Open one other letter, minus 25 points2. Open the first letter, deducted 10 pointsCopyright:The pictures on the game Guess Icon country is mostly taken fromPixabay website (http: // pixabay) and licensed cc0 1.0 Universal /Public Domain Dedication (free to use).If there are things that are not pleasing in the game Guess Iconthis country, please contact us.Do not forget to comment and rate for this application.Thank youHope it is useful
Si Boy Jadi Pilot 1.0 APK
Ayo wujudkan impian Si Boy Anak Jalanan menjadi pilot yang hebatdengan memainkan game Si Boy Jadi Pilot Cara Main: - Kontrolpesawat Si Boy dengan menekan/menyentuh layar (tap) - Hindariburung yang berterbangan - Jangan sampai pesawat terjatuh -Kumpulkan sebanyak-banyaknya skor - Dapatkan Skor Tertinggi danbersaing secara online dengan pemain lain Jangan lupa dukung terusGame Si Boy Jadi Pilot dengan memberikan Rate, Share & Komentaragar kami bisa mengembangkan dengan lebih baik. Terima kasih
Lagu Ratna Antika 1.1 APK
Lagu Ratna Antika merupakan aplikasiKumpulankunci gitar dan lirik lagu Banyuwangi dan koplo dari RatnaAntika.Adapun kunci gitar lagu Ratna Antika pada aplikasi ini,antaralain:1.Dangdut Jamaika2.Grajagan Banyuwangi3.Jaket Iki4.Lonte5.Ojo Njaluk Pegat6.Perahu Layar7.Rumangsamu Yo Penak8.Sambel KemangiHak Cipta:Lirik dan lagu pada aplikasi ini merupakan hak cipta daripencipta,penyanyi, maupun label rekamannya.Mohon maaf jika ada kesalahan penulisan lirik dan kuncigitarpada aplikasi Lagu Ratna Antika ini, silahkan beritahukami.Jangan lupa untuk memberi komentar positif, share maupunratebintang lima untuk aplikasi ini, agar kami bisamengembangkandengan lebih baik.Terima kasihSemoga bermanfaatSongs Ratna Antika isaset of key applications guitar and song lyrics from BanyuwangiandRatna Antika koplo.The key guitar Ratna Antika songs on this application,amongothers:1.Dangdut Jamaica2.Grajagan Banyuwangi3.Jaket Iki4.Lonte5.Ojo Njaluk Pegat6.Perahu screenYo 7.Rumangsamu PenakBasil 8.SambelCopyright:The lyrics and the songs on this application is the copyright ofthecreator, singer, and record label.We apologize if there was a typing error in the lyrics andchordon the application Songs Ratna Antika this, please letusknow.Do not forget to give positive comments, share and rate a fivestarfor this app, so we can develop better.thank youMay be useful
Similar Apps Show More...
Forest Fruit Crush Link 2 APK
Forest Fruit Crush Link 2 is a classic match 3game and you will have to match the fruits or candies with the samecolor!After matching them, the fruits or candies will be crushedand you will gain extra points or other powerful combos!Basicallyyou will have to create he perfect crush the candy or even moreadorable, you will crush the fruits!How To play :- Crush 4 candy soga in a row to blast a jet of candy bubbles whichwill create some other tasty jelly!- Match and crush 3 candy soga jellies to gain some extra moves andbonuses!- Crush 2 bonbon soda to create a big gummy blast!- Crush 5 candy soga in a line to blast a blossom flower whichexplodes other bubbles in the game when combined with cookies andcupcakes!- Crush soda candies as fast as you can and beat the time recordbefore it is running out.- Frenzy all the candies and they will create a colorful blossomeffect!- Enjoy this Cookie soda game and become a master of thecookies!- Combine special cakes to make a candy blast mania!Match and collect everything in Forest Fruit Crush Link in thisamazingly delicious puzzle adventure that will satisfy yourtummy!The forest is full of fruits and the evil bear will try tosteal the honey and the tasty fruits from you!Start your amazingquest and become a legend in the wonderland and candyland!Features:- Tasty jellies and other tasty delicacies can be found in the gamelike: gummy bear, pudding, diamonds, crystals, jewels!- Tons of sweet levels to choose from in the Candy Kingdom- Similar graphics like Rescue the Pet Saga or Jelly the crushsaga!- Collect candies that contain gift time and double yourscore- Match 3 or more candies with the same color to blast themall!- Break the Chocolate topping by crushing the jelly next toit!- Play with tasty pastry items and bubble pudding!- Similar gameplay to other pastry or bakery games in which youhave to match other color bonbons!Download today Forest Fruit Crush Link 2 and start your tastyadventure in the candyland and wonderland!
Fruit Crush 1.0 APK
Switch and match your way through levelsinthis juicy puzzle adventure. Isn't it the juiciest game around?Match three or more fruits to increase your score.Fruit Crush features:● Tasty fruit graphics that will leave you hungry for more● Complete adventurous levels and unlock fruits● Easy and fun to play, challenging to master
Fruit Crush 4.3 APK
Fruit Crush oyununda hedefimiz karşımızaçıkanlezzetli meyveleri ezip birbirinden zevkli bölümlerigeçerekarkadaşlarınıza meydan okumak. İlerleyen bölümlerdekarşımızaçıkacak olan acımasız örümcekten daha hızlı davranarakmeyvelerihapsetmeden toplayabildiğimiz kadar puan toplamak. FruitCrushoyununu Facebook arkadaşlarınızla yarış haline getirerek enfazlabölümü kimin geçtiğini liderlik tablosundan takipedebileceksiniz.Benzer tarzdaki oyunlar arasından halen çok popülerbir oyun olanCandy Crush 'dan esinlenilerek yapılmıştır ve birazdaha heyecanlıolması için Facebook arkadaş listenizde oyunaeklenmiştir.Fruit Crush game ourgoalis to crush the delicious fruits from each other throughthechallenges we face enjoyable part of your friends. fruitsbrutalacts faster than the spiders, which will be encountered inthefollowing sections to collect as many points as we can gatherfromincarceration. Fruit Crush game by making the most part of theraceyou can follow your friends on Facebook who had crossedtheleaderboard. Candy is still a very popular game among the gamein amanner similar Crush 'is inspired from your Facebook friendslistand is added to the game to be a bit more exciting.
Fresh Fruit Crush 1.0.0 APK
Fresh Fruit Crush is a very addictive splash and most interestingmatch-three casual game in the google play! How to play: - Justmatch three or more same identical fruits to score points. - Matchthe fruits until the board transparency,the fruits diamond willappear. - Let the fruits diamond down to last line in the screen topass the level. - Eliminate the more fruits quickly can get extrascores. Game features: - More than 300 challenging levels. - Threegame modes: Arcade, Mineral, Classic - Bomb fruit can eliminate thefruits around. - Timing fruit can extend the playing time. -Lightning fruit can eliminate fruits in one row.
Fruit Crush 1.0 APK
Easy to play but challenging swipeMatchingconnect Fruit Link 3 or more Fruit by putting them on thesameline!Get point by erasing Fruit. You can make longer chain of Fruittoget more points!Fruit link matching How to get 3 stars on every level ?Before you Match 3 Fruit, find the best match.It will take time to understand this, but you will learnafterplaying few levelsSwipe Fruit and Splash them to reach the required score and getthestarsHow to play:* Archive the target points to level up.* Eliminate the more Fruit quickly can get extra scores.* mushrooms Match 3 or more identical Fruit.* Connect three or more same Fruit to score points.* Over 100+ well designed levels
Fruits Crush Splash 1.0 APK
Fruits Crush Splash is game for allages.You Will enjoy and get addicted to it.Its very simple and easy to play.Crush Fruits by joining similar fruit through line.More fruits joined in single go,you will get more score and chancesto complete the level.there are number of levels where you will have to crush the fruitsby joining similar type fruits through tap and move.You can crushtwo or more similar fruits to complete the level.As you go with the levels , fruits will keep changing and hencewill increase the taste. Keep enjoying and have fun playing fruitscrush splash.Play the game and have fun!
Puzzle Top Show More...
Slugterra: Slug it Out! 2.9.3 APK
PLEASE NOTE!The game does not support Android 7.0 or above.Slug it out! and become the best slugslinger of all time! Play ashero Eli Shane in this fast-paced action puzzle game based on thepopular animated television series Slugterra. Collect littlecritters called slugs then fire them out of your high-poweredblaster, transforming them into magical battle beasts! Each slughas its own unique power. The more you use your slugs, the morepowerful they become. Collect all the slugs and use them to battlea horde of villains and stop the evil Dr. Blakk!To play, quickly match tiles on the game board to power up yourslugs. Tap the slug icon to load them into your blaster then watchout as they transform and attack your opponents!The key to being the best slugslinger around is choosing the bestslugs for each round, and knowing when to use them!Players can collect new slugs and unlock slug powers in story mode,or duel an endless stream of opponents to compete for top leaderboard scores in challenge mode.Special items are now available in the store to boost your gameplay.***The Bottom Line: 9.5/10 (Super!) Slugterra: Slug it Out! isn’tthe first strategy match-3 that we’ve played but, by far itincorporates the need for strategy more than others. Tack on anadorable theme and you’ve got one of the best strategy-puzzlersthis year.” – Appstore ArcadeFeatures:• Match tiles on the playing board to power-up your slugs and blastyour opponents• Collect new slugs and unlock slug powers as you play• Battle all of your favourite villains from Slugterra andchallenge Dr. Blakk!• Add all of your favourite slugs to your arsenal, includingInfurnus, Frostcrawler, Tazerling, Flatulorhinkus, Arachnet,Fandango, Doc, Enigmo, Rammstone, Hoverbug, Aquabeek, Makobreaker,Flaringo, Thresher, Frightgeist, Negashade, Ping, Xmitter and manymore!!• Combine two slugs for an incredible fusion shot!• Ghoul your game and add ghoul slugs to your arsenal!• Play through story mode to collect slugs and unlock newpowers• Special items available in the store to boost your game playincluding blaster mods, slug chargers, new characters andmore
graBLOX Puzzle Game 3.4 APK
Use the unique powers of graBLOX to help these little aliens gethome. This dangerously challenging puzzle game will have youscratching your noggin and picking your brain for hours! Thepremise is simple: remove all the BLOX from the board. Since eachBLOX behaves and reacts differently, only those with the cleveresttricks will be able to solve all the puzzles. Think you’ve got whatit takes to think outside the BLOX?And NOW, you can create your OWN levels using the graBLOX LevelBuilder! Use any of the BLOX to create your own levels. Send yourlevels to your friends, or send them to us and you could see alevel with your name on it in a future update!
Tiny Thief 1.2.1 APK
Join Tiny Thief on a big adventure!“Utterly charming.” - Kotaku“Delightful” - The Guardian“A game anyone can enjoy, and it's probably going to make yousmile within the first minute.” - PC Mag“Cute, clever, and oddly rewarding.” - 148 Apps“If you need a good puzzle game today, or heck, even a smile,you should probably go grab Tiny Thief.” - Touch ArcadeIn a world of greed, corruption and injustice, one little guydecides to stand up for the little guy! Say hello to Tiny Thief, anunconventional hero who uses cunning and trickery to out-smart hisopponents across six epic medieval adventures. But beware! He facesfearsome foes, like the Dark Knight, rogue pirates and even a giantrobot!Tiny Thief brings back the magic from the point-and-click gamesof old, charming you with its very own visual style and offbeatsense of humor.The game throws some seriously mind-boggling puzzles at you,with tons of surprising interactive gameplay elements along theway. So get ready to embark on an epic quest to save a princess andkingdom in peril!Six big adventures – sneak and steal your way through six epicquests, featuring an awesome pirate ship and daring castlesiege!Use cunning and skill – out-smart your tricky opponents usingthe element of surprise and some downright sneakiness!Unexpected surprises – explore fully interactive levels anduncover hidden treasures and other surprises at every turn!Tiny Thief is ready to start his big adventure. Are you?What's new in update 1.2.0:UNLOCK A FULL NEW EPISODE WITH A SIMPLE PURCHASE: In this newmagical adventure, the King is kidnapped by the Wicked Witch! Torescue him, our tiny hero will have to turn to dark magic for help,and fight witches and their evil spells. The final battle is aclassic duel with a dragon! Can Tiny Thief break the spell and freethe King?EPISODE INCLUDES:- 5 New, magic-filled levels- 18 Hidden objects to find- 10 New characters including witches, ghosts and dragonsPlease be aware that Google Play is required to make in-apppurchases.Terms of Use: http://www.rovio.com/eulaPrivacy Policy: http://www.rovio.com/privacyImportant Message for ParentsThis game may include:- Direct links to social networking websites that are intended foran audience over the age of 13.- Direct links to the internet that can take players away from thegame with the potential to browse any web page.- Advertising of Rovio products and also products from selectpartners.
Roll the Ball® - slide puzzle 20.1028.09 APK
More than 80 M downloadsworldwide.Here comes new BRAIN TEASERS from the maker ofBlock!, Pipe Lines : Hexa & Words Crush:Hidden Word!.Roll the Ball® - slide puzzle is a simple addictive unblock puzzlegame, keep you playing it!Do you like the game genres as below? Great! Roll the Ball® - slidepuzzle has all the elements. ;)• Sliding Puzzles, Just move and move!• Puzzle Games, Thought-provoking fun.• Maze Puzzle Games, Escape the maze.• Brain Teasers, Test yourself. Exercise your brain.• Physics Puzzler, Physics-based gaming.• Match-3 Puzzle, Easy to learn but hard to master.• Retro Games, Revisit the classics• Exam Prep & Tutoring, Practice makes perfect. Trainyou brain to active mind.• Family Puzzle Games, Enjoy the game with yourfamily.Move the blocks with your finger to create a path for moving theball to the red GOAL block. But riveted blocks can't be moved. Areyou ready to play? Download and start solving puzzles now!FEATURES• SLIDING PUZZLE- An essential is for the adult to kids of all ages.• TONS OF EPIC LEVELS- You can enjoy the game enough.• NO TIME LIMIT- Play at your own pace.• NO WIFI? NO PROBLEM!- Games you can play offline.• MORE VARIATIONS- Moving, Rotation mode to challenge & Star mode torelax.• USEFUL IN-GAME FUNCTIONS:- RESTART: Just restart a level quickly.- UNDO : Have a mistake? Don't worry, just put it back.- HINTS : It's a good friend. Of course, it may be wrong.• GET DAILY BONUS & GIFTS- The Santa may give gifts to you. Check a message box often.• ANNOYING ADS? NO PROBLEM!- Buy AD FREE(USD 1.99) or Participate in ads improvement programby in-game Email.• OPTIMIZED ANDROID & GOOGLE PLAY GAMES- Support both PHONES & TABLETS.- Support both ARM & x86 DEVICES.- Support GOOGLE+ recommendation.- LEADERBOARDS & ACHIEVEMENTS from Google Play Games.- CLOUD SAVE: Your game progress is being saved online with GooglePlay. You can sync your game progress between devices, phones &tablets using the same Google Play Account. It's support gameprogress only, not hints, not auto-save. Be careful, if you tap the"Save" or "Load" button, it will works at once.- MULTIPLAYER GAME : It's required to sign-in Google Play Games. Itconsists of Basic, Star and Rotation modes. The Star mode inmultiplayer game is fake, easy to say, Ignore the stars. Beat theother players worldwide. Invite your friends and enjoy the gametogether!• UP-TO-COMING WITH GOOGLE PLAY- QUEST, GIFTS, APP INDEXINGNOTES• Roll the Ball® - slide puzzle contains the ads like banner,interstitial, video and house ads.• Roll the Ball® - slide puzzle sells In-app products like AD FREE,Hints and level packages.E-MAIL• [email protected]•https://play.google.com/store/apps/dev?id=6249013288401661340Like us on FACEBOOK• https://www.facebook.com/BitMangoGamesLet's ROLL THE BALL. Let's CRUSH THE PUZZLE. lol[AWARD]- 2016-01-08 : New & Updated Games (133 countries)- 2015-12-17 : New & Updated Games (98 countries)
Sokoban Garden 3D APK
Feed your brain with classic puzzle game incompletely new high-end 3d edition. Visit the magical garden andguide cute ladybug through mind-blowing puzzles to unlock newchallenges.*Silver Medal from Playandroid.com magazine*"Beautiful graphics and easy controls. Easily the best Sokoban gameout there" - ***** review on Google PlayATTENTION: This game is an implementation of a great classic puzzlegame and can help you keep your brain in shape! What are youwaiting for? Get it for FREE now!Here are some distinctive features of this game:* Eye candy 3D cartoon graphics* Increasing difficulty - if you find first levels too easy thenplease don’t be upset - solve them quickly and get into seriouschallenge!* Game is optimized for tablets - looks great on Nexus7 or GalaxyNote 10.1* Switch-able 2d/3d view mode* More than 100 levels and counting* AI techniques are in use to improve control scheme* A lot of different control schemes: swype, box dragging, tap,graphical buttons.* No need to download additional files, just install and play* This game comes with in app payments and there are two featuresthat are accessible only through them: disabling ads and checkingsolution for problematic puzzles. But please be aware that if youcan't solve a puzzle you can simply 'surrender' and go to the nextone for free.* Also there is no need to pay for puzzles - you can unlock newones by collecting stars and improving your score.Are you ready to take the challenge?Original concept is also known as: "warehouse keeper", "push box"or "mouse and cheese"------We are a very small indie development team (only one programmer andone 3d artist), so please be tolerant for us!If you’ll find a bug or have any other suggestions please contactus: [email protected]!This software was created with open source tools:Audacity, Blender, Eclipse, Gimp, Inkscape, libGDX, Ubuntu,Universal Tween Engine, Yasc
Cookie Jam 11.0.123 APK
JAM your cookies before they crumble in CookieJam! Sprinkled with a deliciously sweet twist, this match-3 game isequal parts fun and challenging.Blast through bakery islands and help Chef Panda match and crunchthrough hundreds of exciting levels! Hop in your traveling bakeryto set sail on this free puzzle adventure. Swap candy, cookies, andcakes to explore mouth-watering patisseries from around theworld.Got a sweet tooth? Curb your cravings with this calorie free treat!You can have all the cookies, cake, candy and treats that you want!Whip your way though hundreds of addictively sweet match 3challenges by concocting scrumptious cookie combos. Crunch andcrush as fast as you can, or your batch will be ruined by theGingerbread Man!KEY INGREDIENTS:◆ Never-ending fun with THOUSANDS of unique levels and more tocome◆ Deliciously sweet supply of power-ups and combos◆ Swap, crush, and jam your way through fantastical bakeryislands◆ Fun and easy game to learn, but a rewarding challenge tomaster◆ Free and filled with adventure!TOPPED WITH:◆ Special rewards and events all the time◆ Facebook connection so you can share the adventure withfriends◆ Seamless sync across multiple devices and platforms!LIKE: https://www.facebook.com/PlayCookieJamFOLLOW: @SGNgamesDEVELOPER INFO: Jam City is the leading developer in trulycross-platform social gaming! Check out our other free match 3puzzle games! You'll love to swap, match, and crunch through everexpanding levels and events. Check back often to see all the newcake and sweet treats that we've added! You'll love to jam througheach sweet puzzle. Begin your bakery adventure on this free matchthree puzzle game today!
Trainyard Express APK
"The best puzzle game ever.""Devilishly addictive!" - Gizmodo"You'll wrack your brains for hours!" - TapMagazine"All aboard! Trainyard is a five star puzzle experience whose railseveryone should ride." - Gamezebo"Trainyard is as fully featured as a puzzle fan could want." -Appspy"It's a clever concept, simple to grasp but with a lot of variety."- 148AppsTrainyard Express is a puzzle solving game unlike any that you'veever played. It's easy to learn but very tough to master. Your jobis simple: get each train to a goal station. Red trains go to redstations, blue trains go to blue stations, etc. You control thetrains by drawing track for them to follow. There isn't a timelimit or even a score; the only thing you need to do is figure outa solution for each puzzle.Trainyard Express Features:+ Innovative and challenging puzzle mechanic+ Smooth difficulty curve+ Over 60 fantastic puzzles+ Hundreds of ways to solve each puzzle+ Solutions can be found on Trainyard.ca+ Looks GREAT on tablets!+ Engineered for low battery usage+ Colour-blind mode+ A year in the making+ Developed in one person's spare time(support indie games!)The first few puzzles are almost too easy, but as the difficultyincreases you'll be thankful that you were able to practice thefundamentals of drawing track. As the game progresses, you'll haveto use basic colour theory to combine trains of different colours,use timing to merge, and use every inch of your brain in your questto beat the game.What's the difference between Trainyard and Express? In the fullgame there are more than 100 more puzzles!The full game also has splitter pieces, which are AWESOME.Stuck on a puzzle? There are over 1.2 MILLION player submittedsolutions at http://trainyard.ca/solutionsFind out more at http://www.trainyard.caDeveloped by Matt Rix ([email protected])
Fishdom 7.23.0 APK
Never Fishdomed before? Take a deep breath anddive into an underwater world of match-3 fun with Fishdom, anall-new free game!Try challenging and fun match-3 gameplay with unique puzzles as youdecorate aquariums to create cozy homes for lovely talking fish.Feed them, play with them, and watch them interact with each other.Hey, your finned friends are waiting for you, so dive in now andenjoy this amazing underwater adventure!Features:● Unique gameplay: swap and match pieces, design and decorateaquariums, play with and take care of fish—all in one puzzlegame!● Play hundreds of challenging and fun match-3 levels● Compete with other players to develop your aquarium evenfaster● Explore an exciting aquatic world with funny talking 3D fish thateach have their own personality● Liven up fish tanks with breathtaking underwater decor● Grab your scuba mask and enjoy amazing aquarium graphics● It’s a blast for everyone: share your Fishdom mania with yourFacebook friends!● No Wi-Fi or internet connection required to playPlease note that Fishdom is free to play, though some in-game itemscan also be purchased for real money.Enjoying Fishdom? Learn more: Facebook: facebook.com/FishdomInstagram: https://www.instagram.com/fishdom_mobile/ Twitter:https://twitter.com/FishdomOfficialQuestions? Contact our tech support at [email protected].