Description
App Information Daily Life
- App NameDaily Life
- Package Namecom.dailylife.dailylifehealthfitnesswellnessapps
- UpdatedJune 12, 2015
- File Size1.8M
- Requires AndroidAndroid 4.0 and up
- Version1.0.0
- DeveloperTrue Solutions
- Installs500 - 1,000
- PriceFree
- CategoryHealth & Fitness
- Developer
- Google Play Link
True Solutions Show More...
Pro Photo Editor 1 APK
Free Pro Photo Editor is a powerful photoeditor with many amazing effects.Photo editor is a fun app for your photo to be in new look.There are so many features likes effects, stickers and many more toapply to your photos via pro photo editorPro photo editor is free to use.Key Features:One-tap auto enhance your photoGorgeous photo effects and frames for your photoFun stickersColor balance on photoCrop, rotate, and straighten your photoAdjust brightness, contrast, color temperature, andsaturationSharpen and blurColor temperature (“Warmth”)Color SplashFocus (Tilt Shift)Draw and add textCreate your own memesShare to social networkand many moreJust download the Pro photo editor and enjoy
Bollywood actress oops pic 0.0.2 APK
Bollywood actress oops pic update everypicture of bollywood actress dailyDaily update of bollywood actress life picture and news.The daily update of following actressSunny LeoneKatrina KaifDeepika PadukoneAlia BhattPriyanka ChopraAishwarya Rai BachchanKareena Kapoor KhanAnushka SharmaShradha KapoorSonakshi SinhaSonam KapoorPoonam PandeyChitrangada SinghJacqueline FernandezBipasha BasuAnushka SharmaMalaika Arora KhanMonica DograNargis FakhriNeha DhupiaNeha SharmaKangana RanautShriya SharanShruti HaasanVidya Balanand more actressDownload and install it now and don't miss the hot pic ofbollywood actress and their daily life news.Note: Copyright of the content should be to the respective ownerof the original content.
Love Calculator 1.0 APK
Love calculator is all in one app.You will get : Love Calculator,LoveMeter,FriendshipCalculator,Relationship Calculator. Its great funto have it on yousmartphone. You can check with any name that howyour relation willgoes. How strong your relation is with Lovecalculator. Lovecalculator is fully offline based app.Note: Don't trust this app when you are in real love . Thisappis only for fun.
Daily Life 1.0.0 APK
Daily life app is here for your daily fitness , health and wellnesstips and news. Every minutes we will update you with new tips andnews related to solve the health issue and medical tips to help youin different waysWhat you will get from this app are listed bellow :101 recipes for a healthy kids diet a parents guide to healthysnacks sack lunches and deserts that your kids will love200 healthy smoothie recipes free53 healthy lunch box recipes for babies toddlers and kidsapps for eating healthyapps for mental health professionalsbest paleo desserts 33 scrumptious valentines day recipes withgrain free \u0026 gluten-free baking \u0026 healthy dessert recipes(scrumptious low fat chocolate desserts - no more foodallergies)clean eating clean eating recipes for a healthy clean dietclean eating made simple a healthy cookbook with deliciouswhole-food recipes for eating cleandaily healthy eating planeating healthy appsfitness and exercise and health apps freefree health and fitness appsfree health and fitness walking appfree health appsfree healthy food recipesfree healthy food recipes for diabeticfree healthy recipesfruit infused water best vitamin water recipes for weight lossdetox refreshing healthy energy boost and metabolism boostinghealthhealth and fitnesshealth and fitness appshealth and fitness apps for menhealth and fitness apps for teenage girls freehealth and fitness apps for womenhealth and fitness apps for women freehealth and fitness apps for women free walkinghealth and fitness walkinghealth and fitness walking calorieshealth appshealth apps for menhealth apps for womenhealth apps freehealth apps that helps you lose weight and fasthealthy and delicious food recipes freehealthy cooking recipes clean eating editionhealthy drinks recipes for weight losshealthy eatinghealthy eating appshealthy eating apps for kidshealthy eating for pregnancyhealthy eating menu plannerhealthy eating planhealthy eating recipeshealthy food recipes for kidshealthy food recipes for weight losshealthy food recipes for weight loss freehealthy food recipes freehealthy recipeshealthy recipes and menu planninghealthy recipes for kidshealthy recipes for kids for freehealthy recipes for weight losshealthy recipes freehealthy smoothie recipes apps freehealthy smoothie recipes freehealthy weight loss cookbook recipes for android freequick easy healthy recipes healthy grain free and smoothierecipesthe clean eating 28-day plan a healthy cookbook and 4-week plan foreating cleanthe clean eating cookbook \u0026 diet over 100 healthy whole foodrecipes \u0026 meal plansæwalking for fitness pleasure and healthwater and eating healthy and excercicing appsCHILDRENS HEALTHConceivingPregnancy guideCONTRACEPTIONSex guideLOVE AND RELATIONSHIHealth A-ZWOMEN’S HEALTHMAKE-UPANTI-AGEINGHAIR LOSSHAIRCAREHOME REMEDIES FOR BEBody-Mind-SoulWEIGHT TRAININGHEALTHY RECIPESDIETWeight lossYOGAApp features:Easy navigationGreat UISliding controlRefreshand many moreDisclaimer -All copyrights©, trademarks™, registered® materials, icons,contents, logos, graphics, images and/or data are property of theirrespective owners.We do not advertise or sale any product or anything by this app,this app is only for tips and news to share with people and anyoneusing this app asked to decide his/her choice.
Expense Manager-Daily, Monthly 1.0 APK
Expense manager-Daily Monthly is a essentialapp that you need in daily life. Every person should track theirexpenses . With this app you will not forget about the money yourspent and who ever borrowed from you. If any friend borrow moneyfrom you sometimes you forget ! Now its time to remember allexpense with this simple and very light expense manager app. Seethe features bellow of this daily need app Expense manager dailymonthlyAlso this app is password protected and if you forget the pass ithas the recovery option in your emailExpense Manager-Daily, Monthly Features :Set password for secure transaction.– Set Valid Email for recovery your password.– Set your Monthly Budget.– After Login into application.Expense Manager-Daily, Monthly : ADD TRANSACTION PAGE– Select your categories to pay money. If you can add morecategory to open “ Manage Category ” and Add it.– Enter Full Description of payment.– Enter pay Amount.– If you give money in your friend add them in member field. MemberAdd in “ Manage Member ” tab.Expense Manager-Daily, Monthly CHART REPORT PAGE– Select expanse date to see chart report.MANAGE MEMBERS PAGE– Give Money in your friend there name and number puthere.– If you delete unnecessary member delete it.Expense Manager-Daily, Monthly -MANAGE CATEGORIES PAGE– Would you like to add other category to add here.– And delete unnecessary category if you can needed.Expense Manager-Daily, Monthly -VIEW TRANSACTIONS PAGE– Select your categories and Date.– If you can wish to edit and delete category or expanse to modifyhere.– Create PDF File for backup your transaction.Secure Manage with Protection.Add Transaction Details.Add List of Category and Modify it.Easy to Handle All Category.View Transaction Details and Create PDF File of All Transaction andSave it.Add Member to Classified, Which Member Include that Expanse.Change Password and Forgot it.Create a Backup of Your Database to Restore Your Information ifNecessary and Export it.See Chart Report of Transaction.No Need to Required Internet Connection.
Similar Apps Show More...
Clean Eating Magazine 17.0 APK
Much more than a source of delicious and convenient recipes. Ourteam are recognised and respected chefs, nutritionists, healthpractitioners and fitness professionals who will provide you withthe expertise and inspiration to help you improve your health,fitness and overall outlook on life. So get a copy of theAustralian Clean Eating Magazine App today and improve your life -one meal at a time.
Clean Eating 1.01 APK
Clean Eating is a lifestyle not a diet.The Clean Eating App will provide you with news, videos andinformation to help you lead a healthy life. With regular updatesfrom various sources on everything Clean Eating, you can begin yourClean Eating lifestyle and be motivated to maintain it.Eat Clean, Eat Healthy and Eat Well. Be informed with the CleanEating App.Health tips and conversations are sourced from various resourcesto help support a healthy lifestyle.
Clean Eating Recipes 1.0.8 APK
Following on from their popular socialmediapage 'Clean Eating Recipes', comes the Clean Eating Recipes™app.Starting a clean, healthy lifestyle that the whole familywillenjoy has never been so easy! This app eliminates textbookexcuses"it's too hard with the kids", "I have to make separatemeals foreveryone", "it's too hard to make", "I was always hungry"etcUser friendly features include Calendar Planner, ShoppingList(which can be emailed), tips on building a clean pantryandFacebook interaction will help you bake, roast and serve yourwaythrough our app with ease and success.Easy step by step recipes with a nutritional breakdownforeach!Start today and enjoy mouthwatering examples such as:- Spaghetti Bolognese- Gluten Free Chicken Schnitzel- Pancakes- Pizza- Desserts- Plus heaps more!We guarantee to turn your favourite comfort foods andfamilyclassics into clean, healthy alternatives that everyonewilllove!Never experience bland, boring food again.Unlock the secrets to a clean eating way of life!* Stocked with 74 Recipes!* More Recipes to be added in updates!* Lose inches off your waistline while enjoying meals theentirefamily will love!* Come to our facebook page to read testimonials from fellowCleanEaters!* Say goodbye to tasteless boring food!* Support on our facebook page!http://www.facebook.com/CleanEatingRecipesThank you for your support!The Clean Eating Recipes Team.TESTIMONIALS :** T.L : thanks to clean eating and the knowledge I have gainedihave reduced my cholesterol from 7.6 to 4.9 in 4 and a bitmonths!Lost 6 kilos, gained muscle and feel so much healthier!keep up thegood work Clean Eaters.. :)** S.L : Just tried the clean lasagne, absolutelyawesome!!!!Best lasagne I've ever had!!!** S.M : Loving this site and loving clean eating 4.3monthsinand 16.3 kg gone and my body has tone and muscles in places ihaveonly dreamed of. Keep up the great work** S.A : I've been clean eating since December 26. I've lost16pounds and I've NEVER had so much energy!
ETL 3.9.0 APK
In der EAT TRAIN LOVE App findest du allePosts meines gleichnamigen Healthy Living Blogs. Dort dreht sichalles um Clean Eating, gesunde Rezepte, Fitness, Laufen, Yoga,glückliches Leben und Entspannung. Sei dabei und lass dichinspirieren!Mit der kostenlosen EAT TRAIN LOVE App verpasst du keine Beiträgeund kannst meine neueste Posts direkt auf deinem Smartphone lesen.Viel Spaß dabei!In the EAT TRAIN LOVE appyou'll find all the posts of my eponymous Healthy Living blog.There is all about Clean Eating, healthy recipes, fitness, running,yoga, happy life and relaxation. Join us and be inspired!With the free EAT TRAIN LOVE app you missed any posts and can readdirectly on your Smartphone my latest posts. Have lots of fun withit!
Health & Fitness Top Show More...
adidas train & run 4.7.2.30.42432e5 APK
Get fitter, leaner and stronger withadidasTrain & Run – our free fitness and running app withexpertreal-time voice coaching. This free training app turns your smart phone into yourpersonaltrainer, providing real-time coaching, voice feedback andfreecardio and strength training plans. adidas Train & Runlet’syou track your heart rate, pace, speed, routes, calories andyouractivity when paired with a FitSmart. View your workouthistory,heart rate curves and route maps with your training heartrate zonedisplay. Whatever your goal, be it to get off the couch, lose weight,shapeand tone, build strength, get faster, improve endurance,complete a5k or run a marathon, this fitness app will help youachieve yourgoals faster. Train & Run keeps you inspired and inthe know,helping you work out more efficiently and to stay activeeventhrough the rough times. The App allows you to construct a routine made just for you.Weeklygoals let you track your progress and set new goals eachweek.Longer-term training plans provide a complete coached work outsoyou can reach your best. Share your progress and achievementswithyour friends and inspire others to get active too. Download the Train & Run App today to get moving andstarttracking your workouts. Key app features and benefits: - Track every element of your life with daily activitytrackingcapabilities tracking steps taken, calories burned anddistancecovered when paired with your Fit Smart.- Get training tips, motivation and inspiration from weeklyblogupdates.- Keep your routine fresh and new with access to 100s offreecardio, strength and flexibility training plans.- Let your friends know how your training is going bysharingworkouts and photos to Facebook, Twitter, Instagram, otherfitnessplatforms and more.- Keep track of all your workouts and training schedules to seeallthe hard work you’re putting in!- Listen to your favorite music during runs or strengthandconditioning workouts.- Set personalized weekly goals to help you stay motivated andontrack.- Let your routine work around your schedule, by adjusting goalsandplans.- Tap and go for a fresh new run by mapping workout routesinreal-time with GPS tracking.- Improve faster with the help of real-time voice coaching.- Check just how much effort you put in by analyzing yourzonetraining post-run through colored route tracking.- Have your own personal trainer with coached workouts givingyoumore insights on your activity.- Try sample workouts or create your own favoritecoachedworkouts.- Explore the app while setting weekly goals or addingtrainingplans.- Integrate with other fitness platforms including MyfitnesspalandStrava.- Sync up with your Fit Smart via Wireless Bluetooth™syncing. Want more? Log in to adidas.com/micoach to dive deeper intoyourworkout stats and engage with like-minded people in thecommunityfor training tips and fitness inspiration.
Hamal Guide (Pregnancy Book) 2.0 APK
Hamal Guide (Pregnancy Guide)isanapplicationbased on a book written in Urdu Language.Topics Covered in this books:> Kya App Umeed se hain...> Hamal Ki Alaamten> Hamal ka Thehrao> Hamal Ki ehtyati tadabeer> Khoraak aur Libaas> Ayyam-e-Hamal ki warzishen> Hamila Ki Shikayaten> Hamal ke 9 Maheeneyand many more topics.You can navigate through this book.This app is for Adults and Married People only.
Mardana Kamzori Ka Ilaj/Wazifa 1.2 APK
Mardana Kamzori Ki Alamat1. Aesa mareez jab mubashrat ka irada karta hai to azu meinsakhtikaamal waqti tor par ubharta to hai magar kuch hi dairmeinsakhtikhatam ho jati hai.2. dakhol se pehle ya foran baad inzal ho jata hai. Suratinzalkayeh amal mareez ki had se ziyada barhi hui jinsi hassasiyatkisababse hota hai.3. Aghlam bazi ya musht zani ke sabab azu ka terha hona.4. Jaryan ya kasrat e ehtelam se mani (Sperm) mein kamiyamani(Sperm) ka patla hona.5. Azu khaas ke patho ka kamzor hona, jild par siyahi yaragokaubhra hona ya chota pan.Mardana Kamzori Ka Rohani IlajMardana kamzori k ilaj k liye ta husool e maqsad awal o aakhir1111martaba Durood Sharif k sath rozana 2100 martaba Al Qawiparheinorpani par dam kar k piyen.For more [email protected]
Calorie Counter -FDDB Ext. Pro 1.6 APK
Caution:You must installboth,Freeand Pro Version, to use full functionality!FDDB Extender Pro offers you theseadditionalpowerfulfeatures:• No Ads!• Widgets• Detailed Weekly Report of Calories, Micro-andMacronutritionconsumption• Calorie Planner (Set calorie goals for each dayoftheweek)• Nutrition Planner (Set nutrition goals for each dayoftheweek)• Unlimited amount of Quickys (Free Version only offersyoutocreate 3 Quickys!)• Add custom nutrition meals (dummy amountsofCarbohydrates,Fat and Protein)Features:Giant product database• Search food/products by text or barcode• Integrated Barcode-Scanner - find productsfastandeasy• Add products to your favorites• Detailed nutrition information (macro- and micronutritionandmuchmore)Free Food Diary• Grouping by meals (6 separators) or time ofday(3separators)• Quickys (Shortcuts) - Save time while addingproductstoyour diary• Add custom nutrition meals (Pro-Version only!)- Add dummy amounts of Carbohydrates, Fat and Proteintoyourdiary• Create your own lists/recipes• Detailed day summary for calories, activities,macro-andmicronutritionPlan your week!• Calorie Planner - Set calorie goals for each day oftheweek(Pro-Version only!)• Nutrition Planner - Set nutrition goals for each dayoftheweek (Pro-Version only!)• Weekly Report - Detailed analysis andevaluationofGoal-Consumption-Performance (Pro-Version only!)Diet Report• Shown as diagram or as tabular view• Trend of your weight loss/gain on the DashboardGoogle Fit Integration• Calories Expended (from Third-Party-Apps like Nike Running)• Weight entries (from Third-Party-Apps like FatSecret)Notice: You need a freeFDDB-Accounttosynchronize/store your data online. If youtrouble with yourlogininformation please contact the FDDB-Teamviawww.fddb.info.
Change4Life Sugar Smart 2.1.0 APK
Download the Sugar Smart app now to seehowmuchtotal sugar is in your everyday food and drink.TheChange4Life SugarSmart app is designed to show quickly andeasilyhow much total sugaris in the things you’re buying, eatinganddrinking, to help you spotit more easily so you can makehealthierchoices and cut your sugarintake.The app includes over 87,000 popular food and drinkproductsandis based on the most extensive data available tous.We’recontinuously working to improve it and we’re adding moreandmoreproducts all the time.Without us realising it, we’re all eating and drinkingtoomuchsugar:• Children aged 4-6 years shouldn’t have more than 19gramsofadded sugar per day – that’s 5 cubes* • Children aged 7-10 years shouldn’t have more than 24 gramsofaddedsugar per day – that’s 6 cubes* • From 11 years and up, we shouldn’t have more than 30 gramsofaddedsugar per day – that’s 7 cubes*Let’s start scanning! Just scan the barcode and see howmuchtotalsugar it contains**For hints and tips to cut down on sugar, search Sugar Smart.*Based on 4 gram sugar cubes**The number of sugar cubes shown is based on total sugaringramsper pack/100g or ml/portion divided by 4 grams (the weightofone 4gram sugar cube). Images are a representation only.