Description
App Information Crack My Screen Live Wallpaper
- App NameCrack My Screen Live Wallpaper
- Package Namecrownapps.crackmyscreenlivewallpaper
- UpdatedApril 19, 2017
- File SizeUndefined
- Requires AndroidAndroid 3.0 and up
- Version1.0.9
- DeveloperCrown Apps
- Installs10,000 - 50,000
- PriceFree
- CategoryPersonalization
- Developer
- Google Play Link
Crown Apps Show More...
Black Bubble Live Wallpaper 1.2.1 APK
Black Bubble HD is a beautilicious livewallpaper whith rotating glow black bubbles,alos you can pop thebubbles. Choose between lot of colored backgrounds and customizebubbles as you want by determining the direction,density,speed andlot of more options. Play whith Black Bubbles-pop as many bubblesyou can and the points will be shown in the background (you canHide or Display the point counter at the Settings).Black Bubble HD has tons of settings:- CHOOSE BACKGROUND - Select between lot of backgrounds- NUMBER OF BUBBLES - Increase or decrease the amount of blackbubbles- SPEED - Select movement of the black bubbles- DIRECTION - Select direction that bubbles should move- DISABLE BUBBLES - Bubbles are not displayed. Only the backgroundimage is visible.- FRAME RATE - Select how fast the wallpaper is drawn. Increase forsmoother animations or decrease for improved battery life.Adaptyour frame rate on your phone or tablet (higher is better)- DISABLE INTERACTION - Touching moving black bubbles has noeffect- SHOW HIT COUNTER - Display a hit counter in the background.Challenge your friends,pop as many black bubbles you canBlack Bubble HD Live Wallpaper is optimized for both phone andtabletsFind us onFacebookhttps://www.facebook.com/pages/Crown-Apps-Android-Live-Wallpapers-Creations/165465503616177Google+https://plus.google.com/u/0/115662244265827034269/postsPlease rate and comment if you like itFeel free to ask anything
Bubbly Snowflake LiveWallpaper 1.1.6 APK
Bubbly Snowflake is a winter time livewallpaper whith lot of falling snowflake bubbles. Choose betweenlot of colored backgrounds and customize snowflake bubbles as youwant by determining the direction,density,speed and lot of moreoptions. Also you can play,pop as many bubbles you can and thepoints will be shown in the background (you can Hide or Display thepoint counter at the Settings).Bubbly Snowflake HD has tons of settings:- CHOOSE BACKGROUND THEME - Select between lot of cool backgrounds(9 colored background themes)- NUMBER OF BUBBLES - Increase or decrease the amount of bubblesand snowflakes- SPEED - Select movement of the bubbles and snowflakes- DIRECTION - Select direction that bubbles should move- DISABLE BUBBLES - Bubbles are not displayed. Only the backgroundimage is visible.- FRAME RATE - Select how fast the wallpaper is drawn. Increase forsmoother animations or decrease for improved battery life.Adaptyour frame rate on your phone or tablet (higher is better)- DISABLE INTERACTION - Touching moving bubbles and snowflakes hasno effect- SHOW HIT COUNTER - Display a hit counter in the background.Challenge your friends,pop as many items you canBubbly Snowflake HD Live Wallpaper is optimized for both phones andtabletsFind us onFacebookhttps://www.facebook.com/pages/Crown-Apps-Android-Live-Wallpapers-Creations/165465503616177Google+https://plus.google.com/u/0/115662244265827034269/postsPlease rate and comment if you like itFeel free to ask anything
Crack My Screen Live Wallpaper 1.0.9 APK
Crack My Screen is a great live wallpaper.Touch anywhere on the screen to crack your screen, everytime youtouch the screen a new different crack will pop, also you canchoose between lot of colored backgrounds and more options.Crack My Screen HD has tons of settings:- CHOOSE BACKGROUND - Select between lot of awsomebackgrounds- DISABLE CRACKS - Screen cracks are not displayed. Only thebackground image is visible.- FRAME RATE - Select how fast the wallpaper is drawn. Increase forsmoother animations or decrease for improved battery life. Adaptyour frame rate on your phone or tablet (higher is better)- DISABLE INTERACTION - Touching cracks has no effectGhost Touch Live Wallpaper is optimized for both phones andtabletsFind us onFacebookhttps://www.facebook.com/pages/Crown-Apps-Android-Live-Wallpapers-Creations/165465503616177Google+https://plus.google.com/u/0/115662244265827034269/postsPlease rate and comment if you like itFeel free to ask anything
Tech Bubble Live Wallpaper 1.1.8 APK
Tech Bubble HD is a cool live wallpaper whithlot of colored tech bubbles. Choose between lot of coloredbackgrounds and customize tech bubbles as you want by determiningthe direction,density,speed and lot of more options. Also you canplay,pop as many tech bubbles you can and the points will be shownin the background (you can Hide or Display the point counter at theSettings).Tech Bubble HD has tons of settings:- CHOOSE BACKGROUND - Select between lot of cool backgrounds- NUMBER OF NEON BUBBLES - Increase or decrease the amount of neonbubbles- SPEED - Select movement of the neon bubbles- DIRECTION - Select direction that bubbles should move- DISABLE NEON BUBBLES - Bubbles are not displayed. Only thebackground image is visible.- FRAME RATE - Select how fast the wallpaper is drawn. Increase forsmoother animations or decrease for improved battery life.Adaptyour frame rate on your phone or tablet (higher is better)- DISABLE INTERACTION - Touching moving neon bubbles has noeffect- SHOW HIT COUNTER - Display a hit counter in the background.Challenge your friends,pop as many neon bubbles you canTech Bubble HD Live Wallpaper is optimized for both phones andtabletsFind us onFacebookhttps://www.facebook.com/pages/Crown-Apps-Android-Live-Wallpapers-Creations/165465503616177Google+https://plus.google.com/u/0/115662244265827034269/postsPlease rate and comment if you like itFeel free to ask anythingTech Bubble HD is a coollive wallpaper whith lot of colored tech bubbles. Choose in betweenlot of colored backgrounds and customize tech bubbles as you wantby deterministic mining the direction, density, speed and lot ofmore options. So you can play, pop as many bubbles you can tech andthe points will be shown in the background (you can hide or displaythe point counter at the Settings).Tech Bubble HD Has tons of settings:- CHOOSE BACKGROUND - Select in between lot of coolbackgrounds- NUMBER OF NEON BUBBLES - Increase or decrease the amount of neonbubbles- SPEED - Select movement of the neon bubbles- DIRECTION - Select direction did shoulderstand bubbles move- DISABLE NEON BUBBLES - Bubbles are not displayed. Only thebackground image is visible.- FRAME RATE - Select how almost the wallpaper is drawn. Increasefor smoother animations or decrease for improved battery life.Adaptyour frame rate on your phone or tablet (higher is better)- DISABLE INTERACTION - Touching moving neon bubbles has noeffect- SHOW HIT COUNTER - display a hit counter in the background.Challenge your friends, pop as many bubbles neon-you-canTech Bubble HD live wallpaper is optimized for Both phones andtabletsFind us onFacebookhttps://www.facebook.com/pages/Crown-Apps-Android-Live-Wallpapers-Creations/165465503616177Google+https://plus.google.com/u/0/115662244265827034269/postsPlease rate and comment if you like itFeel free to ask anything
Similar Apps Show More...
Broken Screen Live Wallpaper 2.7 APK
Broken screen wallpaper for all fans of broken screen pranks! Makeyour phone look like it was crashed with this awesome livewallpaper. Broken glass prank is very popular nowadays, so go aheadand download ● Broken Screen Live Wallpaper ●. If you're lookingfor cool live wallpaper for phone or tablet, this is the right timeto have your own collection of broken screen wallpapers. ● Choosefrom five beautiful “amazing wallpapers” – more images will beadded each day! ● Animated green, red and yellow sparkles on yourscreen! ● Choose the speed and density of floating objects! ●Parallax 3D effect! ● HD graphics – “cool themes” and “awesomeimages” decorating your screen! ● Optimized battery usage! ●Compatible with 99% mobile devices! ● If the “screen livewallpaper” resets after the reboot, please move it to your phonestorage! ● “Broken Screen Live Wallpaper” looks beautiful on highresolution phones and tablets! Phone customization apps are verypopular nowadays since they make your phone screen look morebeautiful and more extravagant. Here is the best collection of livewallpapers and backgrounds which will make all your wishes cometrue. If you always wanted to have a broken glass screen, you're atthe right place. Have fake broken screen on your phone and enjoythis cool wallpaper app. Kids will love it because they will get achance to pull funny pranks on their friends or their parents, andadults will enjoy having the best collection of ● Broken ScreenLive Wallpaper ●! Broken glass wallpaper will beautify your phonescreen in an elegant manner. When you have a broken screenbackground, you will constantly be reminded to keep your phone safefrom falling down and being smashed. Therefore, these broken glassbackgrounds hd are not only beautiful, but they are also veryhelpful. Create fake smashed screen on your phone and have a newcool background every day of the week. This crashed screen app thatlooks real will make your day! If you enjoy changing livewallpapers on your home screen background, you will surely lovethis amazing live background setter app. Pictures broken screen andbroken glass are very popular right now, so you should hurry up andinstall this awesome collection of cute wallpapers before everyoneelse! You can choose among tens of free broken screen backgroundsand personalize your phone in hd resolution – with ● Broken ScreenLive Wallpaper ●! ● Visit our channel to find more free HD livewallpapers! DISCLAIMER: All images used in this app are believed tobe in public domain. If you own rights, and do not wish them toappear here, please contact us and they will be removed.
Personalization Top Show More...
L Launcher -Marshmallow Launch 2.87 APK
L Launcher, is the most polished, highlycustomizable native style launcher; Smooth, Cool, Rich features;Bring you the best Android™ 6.0 Marshmallow launcherexperience!L Launcher keep updating to Android 6.0 Marshmallow launcherexperience, we had added Android M style drawer, enable it indrawer menu if you want.L Launcher main features:1. Based on Android Lollipop launcher, support for Android 4.0+devices2. Support swipe right to Google Now; enable OK Google from all LLauncher screens(require Android 4.4+);3. Support icon theme, compatible with most icon packs4. Translucent status bar and navigation bar(for Android4.4 +devices and some supported devices, such as Galaxy S4, S5, S6,Galaxy Tab, etc )5. Transparent status bar clone for Android 4.0-4.36. Handy Sidebar, and can drag-out Sidebar anywhere7. Drawer main features: Hide app, Create folders, Sort app, QuickA-Z bar8. Drawer styles: Horizontal, Vertical, Vertical withcategory9. Many Desktop and Drawer transition effect10. Many gestures and Dock icon gesture11. Unread Counts/Notifier for missed Call, unread SMS,Gmail and WhatsApp12. Icon Size Mode: Small, Medium, Large, Extra large13. Live wallpapers: parallax effect, blur, multi-wallpaper14. Backup and restore launcher setting and layout15. Import layout from other launchers16. Android M Marshmallow style drawer17. Highly customizable, 100+ options, below are some mainoptions:[Launcher Desktop:]+ Set launcher desktop grid size+ Set icon size, icon text size/color, hide icon text+ Lock desktop option+ Hide search bar, status bar+ Desktop infinite scrolling; Wallpaper scrolling+ Theme and icon pack support[Launcher Dock:]+ Multi Dock pages; Set number of Dock icons+ Dock icon size+ Hide Dock[Launcher Drawer:]+ Set launcher drawer grid; Set icon size, icon textsize/color+ Drawer folder+ Background transparent[Launcher Sidebar:]+ Launch from everywhere+ Quick toggle; Favorite apps, Recent apps+ Have torch, cleaner and other handy tools[Launcher Folder:]+ Max rows and columns+ Folder background; Folder preview style+ Bulk add for folderPermissions explaination: Please refer to L Setting --HelpFeedback: [email protected] is a trademark of Google Inc.❤ If you like L Launcher, Lollipop Launcher, please rate us andhelp to spread L Launcher;If you meet error, please email us with detailed info, we willcheck and try to fix it ASAP, thanks
CleanUI 2.0.2 APK
CleanUI provides the best flat-style systemUIs for your Android devices. It provides not only the home screen(the launcher), but also the notification page, the lock screen,the control center, the contact and the dialer in flat-style.CleanUI DOES NOT CONTAIN ANY ADS.You can disable some components if this app running lagging on yourAndroid device.1) FLAT-STYLE* It brings clarity to the entire experience. Perfectimplementation the system UIs (the home screen, notification page,screen lock, control center, contacts and dialer) inflat-style.2) HOME SCREEN (LAUNCHER)* Dynamic clock and calendar icons, dynamic color of the titles andthe indicators based on the shade of wallpaper.* Flawless widget support; You can have multiple widget pages (upto eight).* Complete shortcuts management.* Dozens switches and options, which can help the app matches yourAndroid device perfectly: Use widget pages or not; Show all widgetsin one widget page; Show widget pages along with icon pages or showthe widget pages separately.* Powerful customization of icon layout, you can customize the iconsize, icon layout (columns and rows), the size of icon title, andthe color of the title.* Hide and/or Lock icons.* Design icon by yourself; you can apply one design to a specificcategory of icons, not only one icon.3) NOTIFICATION COMPONENT* You can select widgets in the size of 4*N or 5*N to show on theToday tab of the notification page.* You can customize of the color of the status bar for differentapps.* You can select three notification reminder styles: none, banner,or alert.* You can choose whether show the notifications from an app on lockscreen or Badge App Icon.4) LOCK SCREEN COMPONENT* Sliding to unlock and the simple password allows you toexperience the easy and secure lock screen.* You can quickly activate the camera to capture the beautifulscenery without unlock your devices.* Several customization options: you can customize the name of yourdevice, the text of “Slide to unlock”, the name of your operator,lock/unlock/charging sounds, wallpaper, and you can select a widget(4*1 or 5*1) to show on the lock screen.5) CONTROL CENTER COMPONENT* Rapidly control system functions, such as Airplane Mode, WiFi,Wireless, Bluetooth, and so on.* Quick launch the frequently used apps, such as flashlight, clock,calculator, and camera.* Control music player and sound volume by setting a 4x1 or 5x1widget.6) CONTACTS & DIALER* Alphabetical list of contacts helps you locate your contacteasily.* Favorites management helps you to manage your frequentcontacts.* Easily manage the call log ordered by all and missed.* Dial Pad provides support for intelligent matching.
GO Launcher - Free Themes & HD Wallpapers 3.30 APK
GO Launcher – 2017 New ThemesArrival!🎨Features on the Go Launcher include:√ GO Theme: Provide 10000+ free mobile themes for android√ Go Wallpaper: Update various sorts of HD wallpapers, includingbeauty, pet and the great landscape from all over the world√ Transition Effect: 20+ screen and drawer animation effects√ Widget: Weather forecast widget, search widget, switches widgetand 2017 calendar widget√ APPs management: Hide & Lock APPs to protect phonesecurity√ Dr. Clean: Boost your phone speedYou can find launcher themes, icons, HD wallpapers & widget inGO Launcher, and customize your home screen, menu and even lockscreen interface with 3D effects.2017 Personalized App with 10000 mobile themesGO Launcher Z is a stylish & personalized application forAndroid phone, which provides more than 10000 beautiful mobilethemes for you. We have professional designers who create abundantstylish launcher themes with a variety of styles every week,including stars, anime, game, cartoon and so on. Screen 3D effects,App Widgets & over 100000 free HD wallpapers are ready for youto customize your home screen, menu and lock screen.Cool launcher App of your mobile phoneWith an independent developed 3D Engine, GO Launcher provides youwith extremely fast and secure operating experience with simple,smooth and awesome 3D effects, dedicated to become the world's bestpartner of users who use Android mobiles in their life andwork.DIY Themer is a useful tool, which will help you design your ownthemes with your own photo and icon. GO Launcher will makes yourandroid phone more stylish and more personalized.It’s time to download GO Launcher Z and experience the best designof the android themes from Go Launcher! We trust that you will findyour favorite launcher themes for android in GO Theme Store.GO Launcher is deeply convinced that your support has drivendevelopment.You say awesome, we say thank you.There will be ad content shown in certain scenes in our app. Formore details, visit https://m.facebook.com/ads/ad_choices.Contact us: [email protected] usFacebook: https://www.facebook.com/golauncherhttp://www.gomo.com
Fancy Switcher 3.1.1 APK
"This switcher isn't like otherrun-of-the-mill, pedestrian switchers. Launch your recent apps withone or two swipes, and enjoy swanky animations and variouscustomisation options" - Playboard.meLooking for a Switcher to fulfill your needs ? Unlimitedcustomization ?Welcome to your new SwitcherFancy Switcher rethinks your task manager experience. Thanks toFancy Switcher, mix business with pleasure. Explore every singlefeature and create YOUR Switcher.Style, customization and pleasureDesign your switcher as you wish.☆ Normal version:• 4 styles: classic, grid, coverflow or Android L• Smart-Slider : switch to last app or directly to Fancy Switcher,with a simple swipe• Sidebar for fast app switching• Background customization• Beta functionality: start automatically Fancy Switcher instead ofthe native one• Hide closed apps• 3D Icon effect☆ Gold version: Unlock all the features• Thumbnails: adjust size, orientation, items displayed, ...• Smart-Slider fully customizable• Unlimited number of apps displayed• Transition effects (Zoom, Slide, Open)• Close apps effects (Trash, Gravity)• Backup and restore your settings• Use your icon pack• Much moreMake it yours.Want to be a beta tester? Go here: http://bit.ly/FancySwitcherBetaCommunityFollow the development on XDA: http://bit.ly/XDAFancySwitcherWhat they say:Top 5 Task Switching Apps DroidViews"It lets you switch apps in a fancier manner, showcasing apppreviews in neat cards coupled with eye catching animations" -AddictiveTips"Want to Quickly Switch between Running Apps? Try FancySwitcher" - XDA"It looks amazing and can be used to completely replace thestock switcher. Swish swish swish" - Playboard.me
FancyKey Keyboard - Cool Fonts 4.7 APK
FancyKey Keyboard is a free, customizedkeyboard for Android with cool fonts, 3200+ emoji, emoji arts,emoticons, personalized themes, autocorrect input and wordpredictions.Download FancyKey keyboard for free to fancy your chattingnow!★★★★★ #1 iOS third-party keyboard, now available on Android!Millions of users ❤️❤️❤️❤️❤️ all over the 🌍🌎🌏, 💯😘😍★Main Features★✔ 3200+ emoji & emoticons & emoji arts✔ 70+ funky fonts✔ Advanced auto-correct & auto-suggest engine✔ 50+ themes available to choose from✔ Fully customizable keyboard wallpaper and layout✔ 50+ typing sounds✔ Integrated emoji & emoticon keyboard which is compatibleacross all popular apps✔ One tap to input nicely crafted emoji compositions✔ Multiple typing effects✔ SWIPE input method✔ Clipboard for multiple fast copy and paste✔ Multiple emoji styles, such as EmojiOne✔ 50+ languagesEasy steps to customize your own keyboard:• Take a photo or select a photo from your album or pre-loadedimages as background.• Customize key font and color.• Customize typing effect.• Customize swipe line & effect.• Customize typing sound.• Multiple key styles to customize: White, black, steel, wooden& modern.• Customize key shape, color, shadow, etc.Now you're ready to go with your custom cool keyboard.More themes, fonts, emoji, emoticons and exciting features will beintroduced in upcoming updates.Note: We don't collect or use any of your private information whileyou're typing nor we collect the photos you set as wallpapers. Weonly use the words typed by you to make the predictions moreaccurate.FOLLOW US:👍We love hearing from you. Contact us 📧 [email protected] rate us today!Twitter: @FancyKeyFacebook: http://facebook.com/fancykeyboardInstagram: @FancyKeySupported Languages:EnglishEnglish(GB)English(US)Francés(Canada)Francés(France)Francés(Suisse)Español(ES)Español(MX)Español(US)Português(BR)Português(PT)РусскаяالعربيةDeutschItalianoHinglishहिन्दीHinglish-Hindiதமிழ்తెలుగుবাংলাગુજરાતીಕನ್ನಡമലയാളംਪੰਜਾਬੀاردوDanskNorskSvenskaSuomiNederlandsPolskiČeskýHrvatskiLatviešuRomânăSlovenščinaСрпскиTürkçeΕλληνικήעבריתTiếng ViệtMelayuIndonesia한국어
ChameleMAC - Change Wi-Fi MAC 1.0 APK
ChameleMAC is an application from theChamelephon suite of apps helping users avoid eavesdropping anddata mining. This particular application lets you change your MACaddress on the handset with a single click.This is helpful in a lot of scenarios and completes the ability ofChamelephon devices to stay undetected in networks for a long time.Key features :Simple InterfaceRealtime ChangesAbility to generate new MAC on every reboot!!! Requires ROOT access !!!Has been fully tested on chamelephon devices and is expected towork on MediaTek devices.Especially compatible with MediaTek 65XX devices.
Nova Launcher 7.0.58 APK
The highly customizable, performance driven,home screenAccept no substitutes! Nova Launcher is the top launcher for modernAndroid, embracing full Material Design throughout.Nova Launcher replaces your home screen with one you control andcan customize. Change icons, layouts, animations and more.For my money, Nova Launcher is the best of the AOSP-stylelaunchers available in Android. --Android PoliceNova Launcher has some very capable hands behind it--PhandroidOur favorite is Nova Launcher, which strikes a great perfectbalance between incredible performance and high customizabilitywithout getting too gimmicky and difficult to use--LifehackerChock full of features you won't find in the stock launcher, andcomes highly recommended --Android Central• Icon Themes - Find thousands of icon themes for NovaLauncher on the Play Store• Subgrid positioning - Much greater control than standardlaunchers, Nova Launcher allows you to snap icons or widgets halfway through the desktop grid cells• Color controls - for labels, folders, unread badges,drawer tabs and backgrounds• Customize App Drawer - Custom tabs, Vertical or Horizontalscrolling, Custom effects• Improved Widget Drawer - Widgets grouped by app makes itmuch faster to use• Infinite scroll - Never far from your favorite page, loopthrough the desktop or drawer continuously• Backup/Restore - Sophisticated backup/restore systemallowing you to backup your desktop layout and launchersettings• Scrollable Dock - Create multiple docks and scroll betweenthem• Widgets in dock - Place any widget in your dock, such as a4x1 music player widget• Import Layout - No need to rebuild your desktop fromscratch, Nova Launcher can import from most popular launchers.Including the one that came with your phone.• Fast - Nova Launcher is highly optimized to do it's workquickly and quietly, keeping the animations smooth and letting youuse your phone as fast as you can move your fingers.Nova Launcher PrimeUnlock the following extras by purchasing Nova Launcher Prime• Gestures - Swipe, pinch, double tap and more on the homescreen to open your favorite apps• Unread Counts - Never miss a message. Unread count badgesfor Hangouts, SMS, Gmail and more using the TeslaUnread plugin• Custom Drawer Groups - Create new tabs or folders in theapp drawer• Hide Apps - Keep a clean app drawer by hiding never usedapps• Icon Swipes - Set custom actions for swiping on appshortcuts or folders• More scroll effects - Such as Wipe, Accordion, andThrow