Top 20 Games Similar to Video Player HD
3d video player perfect 1.0.6
3d video player and equalizer for Androidisthebest 3d video player video player equalizer play video fullHDaudiomp3 mp4 and is equalizer equalizer music playerThe 3D video player supports all multimedia videoplayerformats,including AVI rmvb, mp3 MP4, WMV, RMVB, MKV, 3GP,M4V, MOV,TS,MPG, FLV, real time video player music player withequalizerAndPresetsQuicktime pro lists all video files- adjustment of bass and treble- Support for all video and audio formats- fast start and smooth and easy playback with video CV- streaming video support- Support multiple subtitle formats- Load your favorite video files on your device (mp3 mp4,flv,avi,mkv, 3gp and several other formats) * Music Player Pro is based on artists or albums, andthefolderstructure. Music player will guide you to find all themusicfilesin seconds.* The unique equalizer make your music sound moreprofessional.Youare free to control the style of music.Main characteristics:+ This is a simple but powerful music player you caninstallandlisten to the songs now!+ Music player, songs player, mp3 player, etc. Play allyouraudiofiles!+ Loads all the most popular formats of music files.+ Quick search - Quick search for your music+ Listen to music - Listen to music by title, artist,albumorplaylist+ Easy navigation - One key to navigate your music player+ Playlists - create and edit your songs in playlists+ Shuffle Party - Mix your music+ Albums - See the beautiful art of the album inyourmusicplayer+ Notification Control - Music Control from Notifications+ Play queue - View upcoming music This is a simple but powerful music player, you caninstallandlisten to the songs now! Music player, songs player, mp3 player etc Playallyouraudio! Support all popular music file formats. Quick search - Search for your music quickly Play music - Play music by song, artist,albumorplaylist Easy navigation - One touch to navigate inyourmusicplayer Playlists - Build and edit yoursongsintoplaylists Party shuffle - Shuffle your music Albums - View beautiful album art inyourmusicplayer Notification control - Controlmusicfromnotifications Play queue - View upcoming music* Music Player Pro is a powerful mp3 and audio mediaplayerwithpowerful equalizer, quick search all music files,custombackgroundskin theme.* Music player Pro is based on artists or albums, andthefolderstructure. Music Player will guide you find all themusicfiles inseconds.* The unique equalizer make your music sounds moreprofessional.Youare free to control the music style.
Video Player for All Format 1.0.7
HD Video Player is a great music andvideoplayer application on Android, this application supports toplayavi videos and all video player support all formats like MP4,AVI,MKV …It has only 10Mb capacity.Especially this app also help you to play videos on phoneinresolution such as: HD, FullHD or 4K. It's great to enjoy 4Kmoviesor music video right on your phone.The smartphone is not only for listening to calls and texting,butit is an entertainment center with multimedia features suchas:play games, listen to music and watch movies. So Video Viewercanbe used as a hd music player high quality sound with fullequalizerfeatures. Offline video player is the essentialapplication foryour Android phone, and certainly the best videoplayer and musicplayer for you to enjoy the film!Video Player can change the brightness and volume by slidingalongvertical sides of the screen, or you can rewind videowithoutdragging the pointer. Besides, you can also set theapplication torun in the background, and it will play music whileyou using otherapplications.The features of Video Player HD:- Video player for all format: MKV, AVI, WMV, FLV ...- Audio formats of hd video player download like MP3, FLAC...- Support subtitles for video- Music cutting tools are integrated as ringtones- Resolution of free video player for tablets : HD, FullHD,4K...- Full hd video player high quality- The widget on home screen- Beautifully interface, easy to use avi video playerforandroid- Support for video thumbnails- Mp3 and mp4 music and video player free downloadIf you are a big fan of movies, then HD Video Player will helpyourphone be like a real movie theater.
Media+ (Video Player) 7.1.0
The most professional and simplest mediacenterfor android. Support Android 6.0.Playback HD videos and high quality musics, also a greatmultimediacenter.Uses the intelligent detection adaptive algorithm, combined withtheunderlying hardware decoding technology, making the picturemorehigh-definition and video playback smoother.The professional multimedia player software for Android, withitlike with a mini cinema in the side. It is definitely yourbestpartner watching videos on your android devices!Video player features:- Support most of all video formats.- Automatically scan video files.- Supports multiple subtitle formats,automaticsynchronization.- Easy to manage videos.- Play videos as audio.- Video size.(auto fit,fit horizontal,fitvertical,fillscreen,16:9,4:3,center)- Force video chroma.(RGB 32bit,RGB 16bit,YUV)- Video screen orientation.- Theme.(Light/Dark)- Flash formats video - flv, asf videos.- Play video stream.- Local network share.- Hardware acceleration.- Lock screen when playing video.- Video play gestures.(brightness,seek,volume)- Supports self-induced adjust the screen brightness.- Playback seed.- Sleep timer.- Jump to time.- History.Music player features:- Automatically scan music files.-Automaticclassification.(Artists,albums,songs,genres,playlists)- Play audio stream.- Music play gestures.(lock screen,subtitle,play asaudio,removesongs,rearrange order,hold to seek)- Set music as ringtone.- Equalizer.(Flat,classical,club,dance,full bass,full bassandtreble,fulltreble,headphones,largehall,live,party,pop,reggae,rock,ska,soft,softrock,techno)- Theme.(Light/Dark)Supported video formats:rtmp,rtmpe,rtmps,rtp,rtsp,mms,mmsh,icyx,httplive,udp,vlc,3g2,3gp,3gp2,3gpp,amv,asf,avi,divx,drc,dv,f4v,flv,gvi,gxf,ismv,iso,m1v,m2v,m2t,m2ts,m3u,m3u8,mkv,mov,mp2,mp2v,mp4,mp4v,m4v,mpe,mpeg,mpeg1,mpeg2,mpeg4,mpg,mpv2,mts,mtv,mxf,mxg,nsv,nut,nuv,ogm,ogv,ogx,ps,rec,rm,rmvb,tod,ts,tts,vob,vro,webm,wm,wmv,wtv,xesc,3G2,3GP,3GP2,3GPP,AMV,ASF,AVI,DIVX,DRC,DV,F4V,FLV,GVI,GXF,ISMV,ISO,M1V,M2V,M2T,M2TS,M3U,M3U8,MKV,MOV,MP2,MP2V,MP4,MP4V,M4V,MPE,MPEG,MPEG1,MPEG2,MPEG4,MPG,MPV2,MTS,MTV,MXF,MXG,NSV,NUT,NUV,OGM,OGV,OGX,PS,REC,RM,RMVB,TOD,TS,TTS,VOB,VRO,WEBM,WM,WMV,WTV,XESCSupported audio formats:3ga,a52,aac,ac3,adt,adts,aif,aifc,aiff,amr,aob,ape,awb,caf,dts,flac,it,m4a,m4b,m4p,mid,mka,mlp,mod,mpa,mp1,mp2,mp3,mpc,mpga,oga,ogg,oma,opus,ra,ram,rmi,s3m,spx,tta,voc,vqf,w64,wav,wma,wv,xa,xm,3GA,A52,AAC,AC3,ADT,ADTS,AIF,AIFC,AIFF,AMR,AOB,APE,AWB,CAF,DTS,FLAC,IT,M4A,M4B,M4P,MID,MKA,MLP,MOD,MPA,MP1,MP2,MP3,MPC,MPGA,OGA,OGG,OMA,OPUS,RA,RAM,RMI,S3M,SPX,TTA,VOC,VQF,W64,WAV,WMA,WV,XA,XM
All Video Format Player (Lite) 1.8.1
All Video Format Player plays alltheaudio-video file formats smoothly.This Lite version is developed for low end phones.FEATURES:★ VIDEO PLAYERThe player is developed to support the low end devices.It lets you enjoy movies and videos by playing smoothlySupported formats:.3g2 .3gp .3gp2 .3gpp .amv .asf .avi .divx .drc .dv .f4v .flv.gvi.gxf .ismv .iso .m1v .m2v .m2v .m2ts .m4v .mkv .mov .mp2 .mp2v.mp4.mp4v .mpe .mpeg .mpeg1 .mpeg2 .mpeg4 .mpg .mpv2 .mts .mtv.mxf.mxg .nut .nuv .ogm .ogv .ogx .ps .rec .rm .rmvb .tod .ts .tts.vob.vro .webm .wm .wmv .wtv .xesc★ MUSIC PLAYERThe integrated music player lets you enjoy music inyourpersonalized way.Supported formats:.3ga .a52 .aac .ac3 .adt .adts .aif .aifc .aiff .amr .aob .ape.awb.caf .dts .flac .it .m4a .m4b .mid .mka .mlp .mod .mpa .mp1.mp2.mp3 .mpc .mpga .oga .ogg .oma .opus .ra .ram .rmi .s3m .spx.tta.voc .vqf .w64 .wav .wma .wv .xa .xm★ SUBTITLESAdvanced subtitles options like add files, delay andadjustspeed.Supported Formats:.idx .sub .srt .ssa .ass .smi .utf .utf8 .utf-8 .rt .aqt .txt.usf.jss .cdg .psb .mpsub .mp12 .pjs .dks .stl .vtt★ EQUALIZERCustomize the audio experience, adjust 10bandfrequencies.★ PLAYLISTSYou can import/export your favorite play lists tothedevice.Supported formats..m3u .asx .b4s .pls .xspf★ ADVANCED OPTIONSPlayback speed, audio delay, sleep timer, jump to timeandintegrated file browser.★ TIPSDouble tap the "Got It"button,to get rid of onscreen tips.Press back twice to exit video.Please note: The performance is purely dependent on yourdevicecapabilities.The player can run on 256MB RAM also,but we recommend 1GB RAM for optimum performance.If you experience any lag or sluggish performance, Trycleaningdevice memory and RAM.If still problem persists,Please mail us your device specifications and issues with nameofthe player in subject.
Player Video For Android 1.0
Video Player Diamond - The safest andbestmediaplayer for enjoying movies and musics.Video Player Diamond for Android is a high quality freemediaplayerwith material design. This video player plays allpopulartypes ofvideo and audio files including 3GP, FLV, MKV, MP4 ,MP3 ,AVI, MOV,OGG, WAV, FLAC, M2TS and AAC etc. So Video PlayerDiamondcan beused as a mp3 player as well.Player Video For Android is one of the most popularandpowerfulplayer for all android devices. It is easiest androidphoneplayer. This video player support many formats and canplayanyvideo,film,music,MTV that stored on your phone.*- The main function characteristics of PlayerVideoForAndroid:1- Automatically he can scan all videos on your phone.2- The Player Video For Android play with qualityHDandsmoothly.3- With the latest hardware decoder Many videos will benefitfromthelatest hardware decoder.4- Touch screen zoom gesture You can use variety of gesturesonthescreen , zoom in or out is very easily .5- Transfer file to you phone by wifi.You can transfer videofiletoyour phone by browser Also you can transfer video on youphonetoother Phone by wifi。6- Player Video For Android Play FLV files smoothly, noneedtoinstall the Flash Player plugin or other plugin.7- delete video operation easily8- Thumbnail display the contents of all video file*- Features of Player Video For Android :- Fully featured video player For Android- Sleep timer available- Playlist manager- Supports standard formats such as mp4, mov, m4v, 3gp, mpeg- Rotation Lock / Aspect ratio Control- File & FolderManagement:SupportNew/Rename/Cut/Paste/Delete- Mini TV support- Playlist you can Create your own playlist andplayfilescontinuous- Resume Function Don't worry about closingyourapplicationsuddenlyMedia Player other Features :- High quality video processing- Select built-in track & subtitles- Different Play Mode: Support Loop off/Loop One/Loop all- Swipe up increasing the volume- Swipe down decreasing the volume* Player Video For Android the best choice ofyourplayerphone* Player Video Can play any type video music and pdf txtwordorexcel.
Video Player 3.2.2.0
This is a perfect player to playmovieormusic!It uses hardware decoding, which makes the videoplaybacksmoother.Its smart core technology automatically detectsall videoand audioformats files on the SD card types and makes itmoresusceptible toallowing you to enjoy smooth andhigh-qualityvideo.Ultimate perfect video player supports allpopularvideoformats.It supports all popular video formats.Main features:- Automatic search for all mobile phone video and music files- Supports all common video and audio file formats- Supports multiple subtitle formats,automaticsynchronization- Use hardware decoding, the advantages ofusinghardwareacceleration- Takes up little memory, simple operation, quickstart,smoothplayback support- Support for Flash video format- Video thumbnail display- HD video playback memory optimization- Play gesture control- Play history list- Connect online video- Playback speed control- Sleep time setting- Add subtitle files- Quickly rename video- Taskbar shortcuts- Add the Equalizer functionIt allows you to feel the perfect melodic perceptionmoviesandmusic, come try it!
Video Player with Notes & mp3 14.0
Video Player with Notes & Audio Create your own playlistofvideos (mp4, 3gp, mp3, etc) in sequence you want, and writenotesfor each video! Insert your own photos over video or mp3!Displayvertical video in its original form! (not strectched orsqueezed)The first and only Video Player with Notepad, DoubleScreen, 2videos in 1, photos on video. These features are onlyoffered bythis app: 1. Watch video and write notes (saved andexportable) 2.Double screen - control each screen 3. Zoom and Pan -view everyinch, not just center 4. 2 different videos in 1 page -controleach screen 5. Display photos on and below video If you haveIDEAS,just type in text & icons/emojis below the video player.So youdont have to close the video and open your text editorseparately.version 5 - we fixed this app to be compatible withsmall screenphones. v7 Fixed for smartphone - you can play videofrom the listyou created Play videos mp4 3gp flv mov mpeg aviStreaming videosPlay audio files (music, song, speech, lecture) mp3wav ogg Videosare not just for entertainment. They are powerfullearning tools ineducation and professionals. One feature lackingin many videoplayer is the ability to write notes for each video,as you listenand watch. Suitable for students who need to listen tolecturevideo and take notes. Universities and college facultycancustomize this app for specific uses. Suitable as Video Album,withnotes for each video, this is what differentiates this appfromother video players. Make this video player a must-have, youwillbe delighted to find new interesting ways for video and audioPlayvideo and write notes Mp4 3gp mov avi flv avi Audio mp3 wavoggalso can be saved with this app Can play online video withhttphttps rts with video ext (Video Streaming, no downloadnecessary)Just click on a video/audio file from sdcard, memorycard, andusbhost, and choose Video 1Player with Notepad (seescreenshot) Youcan also use included Media Scanner and File Browserto find videosin sdcard, memory card, and usbhost Can pause andcontinue Candisplay track in minutes and seconds Video total lengthisdisplayed (even if the download file is not complete). Canbrowsevideos quickly with next/previous Multi views : watch 2videos.Double-screen, Can play 2 videos simultaneously, can savenote hereas well. Mute (volume zero) video 1 or 2. ScreenorientationPotrait displays video, name, and notes Landscapedisplay fullvideo view. Just rotate your screen. v3 Zoom & Pan- enlargevideo, move screen to view every corner Swipe left/rightto changevideo previous/next In full-screen zoom view, playnon-stop,unchanged, can play in background (listen to music)Videoscreenshot album Quick way of moving picture files to a videoalbumVideo streaming : http://site.com/video.mp4 You can streamvideo ,save the link with note No downloading necessary Use thislink fortest : http://carijodohislam.com/hang.mp4 Can play videowithsubtitle . Put videosubtitle.srt in Videos/mnt/sdcard videofolder, the same folder for screenshots. Suitable for coaching,training,teaching, sports, with video. Audio page : blue screen,you candisplay your favorite video and pictures as decoration. Nolongerboring mp3 player. Gain points to remove ads (or disable wifitoswitch off ads) and limits to new/save video bookmarks, limit of10double-screen. However, there is no limit to openinganyvideo/audio from outside and saving it with note. Buyfullunlimited version Buy customized version for schools,education,organization, companies, businesses We help you buildyour own appsimilar to this app, you can sell or distribute itfreely [email protected] This player is smallin size, only1.5MB, so its worth keeping it. You are welcomed tocontributetoward features e.g. adding video subtitlesminutes/seconds, mp3play, ideas to improve.
Video Player HD Pro 1.0.8
This application is an Ad free version ofVideoPlayer HdFeatures:1 music player with equalizer and presets2 multiple subtitle formats support3 bass and treble adjustment4 support for all video and audio formats------------------------------------------------------------------------------------------Disclaimer:This app is based on VLC for Android Beta, and licensed undertheGNU General Public License ver3 or later.GNU General Public License: http://www.gnu.org/licenses/You can get the source code following this link: https://github.com/FunPanda08/VLCPlayer_Android
Media Player Classic - HD 1.0.11
HD Media Player is a classic HDvideoplayer and great music player.I love media player.It is powerful!!! I love video player* Easy to use, it automatically scans and displayall your videos and music files in the phone or in the SD cardforyou. It is your ultimate multimedia player.* Plays almost all kind of video and audio files including themostpopularSupported FormatMPEG-1/2, DivX® (1/2/3/4/5/6), MPEG-4 ASP, XviD, 3ivX D4,H.261,H.263 / H.263i, H.264 / MPEG-4 AVC, Cinepak, Theora, Dirac /VC-2,MJPEG (A/B), WMV 1/2, WMV 3 / WMV-9 / VC-1, Sorenson 1/3, DV,On2VP3/VP5/VP6, Indeo Video v3 (IV32), Real Video(1/2/3/4).* Support thumbnail of video and music files* Plays almost all kind of Audio formatsSupported Audio FormatMPEG Layer 1/2, MP3 - MPEG Layer 3, AAC - MPEG-4 part3, Vorbis,AC3- A/52, E-AC-3, MLP / TrueHD>3, DTS, WMA 1/2, WMA 3, FLAC,ALAC,Speex, Musepack / MPC, ATRAC 3, Wavpack, Mod, TrueAudio, APE,RealAudio, Alaw/µlaw, AMR (3GPP), MIDI, LPCM, ADPCM, QCELP, DVAudio,QDM2/QDMC, MACE.* Support network video streaming including HLS, you canstreamvideo from the network or from local network directory.* Equalizer - 10 band and a lot of preset values.* playlist for audio* subtitles support, embedded and external, including ASS andDVDsubtitles* Multiple audio or subtitles tracks selection* Multi-core decoding* Support full hardware decoding* Gestures, headphones control* Multiple subtitle formats support* Browse folder directly.* Configurable hardware acceleration.* Music Player Widget* Support play audio only from an video file* Support video searching from the database* Support play video in a small windows and user can use otherappsat the same time.Your best multimedia player!!! Download and enjoy.Trouble shooting:1. If the video do not show up quickly, please try playaroundhardware acceleration which make your videoplay much faster.Disclaimer:This app is based on VLC for Android, and licensed under theGNUGeneral Public License ver3 or later.GNU General Public License: http://www.gnu.org/licenses/
Video Player HD Pro 1.1.1
Video Player HD Pro gives the Adfreeexperience. It supports all types of video format and audioformat.Video player also plays ultra high definition video filestoo.Features :- plays AVI , MP3 , WAV , AAC , MOV , MP4 , WMV , RMVB, FLAC , 3GP,M4V , MKV , TS , MPG , FLV , etc- thumbnail of video and mp3 files.- subtitle support for videos- mp3 cutter for making the ringtone- plays all types video and audio formats including HD videos- mp3 player with equalizer- bass booster for extra bass- multiple widgetsDisclaimer:video player is based on VLC for Android Beta, and licensedunderthe GNU General Public License version 3 or later .GNU General Public License: http://www.gnu.org/licenses/
Archos Video Player
The critically acclaimed Archos VideoPlayerapp offers an uncompromised video experience on tablets,phones andAndroidTV devices.*** Play everything ***- Play videos from your computer / server / NAS (SMB, UPnP,FTP*,SFTP*)- Play videos from external USB storage- Videos from all sources seamlessly integrated in aunifiedcollection- Automatic online retrieval of Movie and TV show descriptionswithposter and backdrop- Integrated subtitle download- Torrent streaming* (previously downloaded .torrent filescandirectly be opened by the application ; note that no torrentsearchengine is included in the application)*** Best Player ***- Hardware accelerated video decoding for most devices andvideoformats;- Multi-audio track and mutli-subtitles support- Supported file formats: MKV, MP4, AVI, WMV, FLV, etc.- Supported subtitle file types: SRT, SUB, ASS, SMI, etc.*** TV friendly ***- Dedicated “leanback” user interface for Android TV- AC3/DTS passthrough (HDMI or S/PDIF) on supported hardware:NexusPlayer, NVidia SHIELD TV, Rockchip and AmLogic basedtv-boxes- 3D support with side-by-side and top-bottom playback modes for3DTVs- Audio Boost to increase the audio level of poorlyencodedfiles- Night Mode to dynamically adjust the audio level*** Browse the way you like ***- Instant access to recently added and recently played videos- Browse movies by name, genre, year, duration, rating- Browse TV shows by seasons- Folder browsing supported, if you prefer it old-schoolstyle;-)*** And even more! ***- Share and keep track of what you have watched usingTraktscrobbler* (see http://trakt.tv/)- Multi-device network video resume- Use descriptions and posters from NFO files when available- Scheduled rescan of your network content (Leanback UI only)- Private mode: temporarily disable playback historyrecording- Manually adjust subtitles synchronization- Manually adjust audio/video synchronization* : only on only in premium/paid version.To get the full version of the application (all features, noads)you can either buy the Paid app or use the inApp purchaseoption inthe free version (and continue to use the freeversion).In case you have an issue or a request about this app, pleasecheckour Google+ support group at thisaddress:https://goo.gl/PXyUfMIf you experience any issue with video hardware decoding youcanforce software decoding in the application preferences.Archos Video Player is compatible with Android 4.0 and above
Video Player Pro 1.0
video Player pro is an video playerdesignedtoplay video form on your phone.video Player pro is easy to use and has simplifiedplaylistwhichdisplays the generalview of all videos in your smartphone instead ofdisplayingalbumsmaking it easyto play.Its Featured video Player pro. You can play thedifferentvideoson your android mobiles of different formats. videoPlayerpro willplay an important role in your phone's use. Its thebestVideoPlayer in google play market to help to play videoinyourphone.We ensure you will love this video player after using it.Ifyouarepursuing a video player with the better user experienceanduserinterface,video Player prowill be your ultimate choice. video Player pro is thevideoplayersupports all the most popular video formatswithoutanyconversion.video Player pro scans your phone's videos and makes youeasiertomanage the videos. It keeps your video playing progressandresumevideo's previous progress.=> video Player pro support all this form Formats:> AVI / AVI Player> FLV / FLV Player> H264 / H264 Player> MP4 / MP4 Player> MPG2 / MPG2 Player> 3GP / 3GP Player> WMV / WMV Player=> Features of this video Player pro:- Its Video player with good features.- See the list of your videos with its details.- Can remove the unwanted videos from the list.- Sort the list with our own choice.- Adjust the brightness with finger swipe.- Control the sound volume with finger swipe.- Seek bar is controlled with finger swipe.- Pinch on the screen to zoom.- Full screen mod is used.- Can repeat the wanted video.- Player controls to play next or previous videos.- Play Pause added.- Get the video details.- Add bookmark to make the favorite list of your videos.- Mute the media volume.- Share your favorite videos with your friends.
Video Player Pro for Android 5.0
Video Player Pro for Android, best waytoenjoyyour movies in your Android.Video Player Pro for Android is the best video playerandhighquality videos plays smoothly .Video player can supports all video formats including AVI , MP4,WMV, RMVB , MKV , 3GP , M4V , MOV , TS , MPG , FLV etc.Andautomaticidentifiy all mobile phone video files. VideoPlayerusing hardwaredecoding, take advantage of hardwareacceleration byusing smallmemory, simple operation, quick start,smooth playbacksupport, quickstart and smooth and easy playbackwith videoresumeVideo Player Pro for Android have a intelligentdetectionadaptivealgorithm makes it more convenient for you toenjoysmoother, betterquality videos, allowing you to quicklylocate andplay thevideo.*Video Player Pro for Android can be used as a musicplayeraswell.Let enjoy it!
Video Player HD 1.2
Video player HD supports all video formats including AVI, MP4,WMV,RMVB, MKV, 3GP, M4V, MOV, MPG, FLV etc. The most powerful&well designed HD Video player for your android phone.Built-inpowerful and intuitive multimedia manager withautomaticidentification of all video files on your device.SupportedFormats: .mp2v .mp4 .mp4v .mpe .mpeg .mpeg1 .mpeg2 .mpeg4.mpg .ogm.ogv .ogx .ps .rec .vob.webm .wm .wmv .wtv.3gp .3gpp .amv.asf .avi.divx .drc . .f4v .flv .mkv .mov .mp2 and 4K Features:--> HDplayback video. -> Thumbnail of video. -> SmartFingerGesture. -> Multiple subtitle formats support. ->Videostreaming support. -> Ultra sound effects. -> AutoLandscape/ Portrait Mode. -> Capture screenshots from a video.->Support auto-rotation, aspect-ratio adjustments. -> Quickstartand smooth and easy playback with video resume.
Video player for android 6.6.2
Video player for android is high qualitymediaplayer with elegant design .Enjoy high quality videos playback smoothly .Supports all video formats including AVI , MP4 , WMV , RMVB , MKV,3GP , M4V , MOV , TS , MPG , FLV etc.Adjust audio experience including bass and treble with powerfulandwell designed equalizer.Key features- support for all video and audio formats- Full featured music player with equalizer and presets- All codecs are included- Quickly open all videos from your SD card, email, the web, oranyother app that supports sharing- multiple subtitle formats support- Gesture support(video playback and music playback)- Easily control display brightness, aspect ratio andscreenrotation during video playback- Widget for music player- Video streaming support(RTSP,RTP, SDP,HTTP/HTTPSprogressivestreaming,HTTP/HTTPS live streaming )
MP4 Video Players 1.0
MP4 Video Players for Android isthebesthd video player. The easiest phone video player that Ithasapowerful video decoding capabilities to easily supportyouplayalmost all video files stored on your phone. Enjoyhighqualityvideos plays smoothly.MP4 Video Players supports all video formats includingAVI,MP4 , WMV , RMVB , MKV , 3GP , M4V , MOV , TS , MPG ,FLVandmore..Features:* Lists all video files from your phone
* Support forallvideoformats
* Quick start and smooth and easy playbackwithvideoresume* Automatic identification of all the video files in thephone* HD playback your video files* Thumbnail display the contents of the video file* Smooth playback
Video Player HD 4K 1.1
HD video player for android isaneasy&powerful video decoding capability video player. HDvideoplayerplays and supports all type of videos and audio fileslikeAVI,3GP, MKV, TS, MPG , M4V, MOV, MP4, WMV, OGG , WAV , AAC ,RMVB,FLVand MP3. You use this App and click on videos and allvideosinyour mobile organized quickly. When you click on audiosthenallaudio songs open. HD video player plays all types ofvideosandplay all length of videos.You can adjust volume and brightness by using touch.Video Player is one of the best player availableinthemarket.because it supports all type of video formats .One of the best media player in video player category.VideoPlayervery easy to use.On start up, it automatically scans and display all yourvideosformphone.This simple mp4 HD Video player is becoming the best videoplayerforandroid in 2016- 2017 , more features will be comingsoon.Thanks forusing this HD video audio player.Key Features of app:--> Automatic video select from your storage.-> video player provide Screen brightness andVolumebuttonprovided to control brightness and volume button.-> video player provided enabled disabled audio trackofyourvideo.-> video player is Small memory, simple operation,quickstart,smooth playback support.-> Display Thumbnail of all videos in your SD card.-> video player Browse folders directly.-> Start the video Player Then list out all the videoinourphone.-> Show All video and Audio of Phone to Play-> Fast and quality. Media player, mp3 audio musicplayerfeatureis available.-> Is a unique application that supports all videoandaudioformats.Thank you Very Much For Your Support and Please Rate 5 starIfYouLike It and to support us!I hope you enjoy this Video Player and encourage meforfurtherapplications.thank you very much from Best Big Media Labs team